CYP4A22 (Myc-DDK-tagged)-Human cytochrome P450, family 4, subfamily A, polypeptide 22 (CYP4A22)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CYP4A22 (Myc-DDK-tagged)-Human cytochrome P450, family 4, subfamily A, polypeptide 22 (CYP4A22)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human cytochrome P450, family 4, subfamily A, polypeptide 22 (CYP4A22), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CYP4A22 (Myc-DDK tagged) - Human cytochrome P450, family 4, subfamily A, polypeptide 22 (CYP4A22), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human cytochrome P450, family 4, subfamily A, polypeptide 22 (CYP4A22), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CYP4A22 (mGFP-tagged) - Human cytochrome P450, family 4, subfamily A, polypeptide 22 (CYP4A22), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CYP4A22 (GFP-tagged) - Human cytochrome P450, family 4, subfamily A, polypeptide 22 (CYP4A22)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-CYP4A22 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP4A22 antibody: synthetic peptide directed towards the N terminal of human CYP4A22. Synthetic peptide located within the following region: MSVSVLSPSRRLGGVSGILQVTSLLILLLLLIKAAQLYLHRQWLLKALQQ |
Rabbit Polyclonal Anti-CYP4A22 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP4A22 antibody: synthetic peptide directed towards the N terminal of human CYP4A22. Synthetic peptide located within the following region: AQLYLHRQWLLKALQQFPCPPSHWLFGHIQEFQHDQELQRIQERVKTFPS |
CYP4A22 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of cytochrome P450, family 4, subfamily A, polypeptide 22 (CYP4A22)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
CYP4A22 (untagged)-Human cytochrome P450, family 4, subfamily A, polypeptide 22 (CYP4A22)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of CYP4A22 (NM_001010969) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CYP4A22 (NM_001010969) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CYP4A22 (NM_001010969) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack