Products

cDNA Clones (7)
Proteins (5)
Antibodies (2)
Jump to Filters
View as table Download
CYP4A22 (NM_001010969) Human Tagged ORF Clone
RC224082

USD 420.00

In Stock

CYP4A22 (Myc-DDK-tagged)-Human cytochrome P450, family 4, subfamily A, polypeptide 22 (CYP4A22)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CYP4A22 (NM_001010969) Human Tagged ORF Clone
RC224082L3

USD 620.00

3 Weeks

Lenti ORF clone of Human cytochrome P450, family 4, subfamily A, polypeptide 22 (CYP4A22), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CYP4A22 (NM_001010969) Human Tagged ORF Clone Lentiviral Particle
RC224082L3V

USD 820.00

6 Weeks

Lenti ORF particles, CYP4A22 (Myc-DDK tagged) - Human cytochrome P450, family 4, subfamily A, polypeptide 22 (CYP4A22), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CYP4A22 (NM_001010969) Human Tagged ORF Clone
RC224082L4

USD 620.00

3 Weeks

Lenti ORF clone of Human cytochrome P450, family 4, subfamily A, polypeptide 22 (CYP4A22), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CYP4A22 (NM_001010969) Human Tagged ORF Clone Lentiviral Particle
RC224082L4V

USD 820.00

6 Weeks

Lenti ORF particles, CYP4A22 (mGFP-tagged) - Human cytochrome P450, family 4, subfamily A, polypeptide 22 (CYP4A22), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CYP4A22 (NM_001010969) Human Tagged ORF Clone
RG224082

USD 460.00

3 Weeks

CYP4A22 (GFP-tagged) - Human cytochrome P450, family 4, subfamily A, polypeptide 22 (CYP4A22)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CYP4A22 Rabbit Polyclonal Antibody
TA346247

USD 475.00

5 Days

Rabbit Polyclonal Anti-CYP4A22 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP4A22 antibody: synthetic peptide directed towards the N terminal of human CYP4A22. Synthetic peptide located within the following region: MSVSVLSPSRRLGGVSGILQVTSLLILLLLLIKAAQLYLHRQWLLKALQQ
CYP4A22 Rabbit Polyclonal Antibody
TA346248

USD 475.00

5 Days

Rabbit Polyclonal Anti-CYP4A22 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP4A22 antibody: synthetic peptide directed towards the N terminal of human CYP4A22. Synthetic peptide located within the following region: AQLYLHRQWLLKALQQFPCPPSHWLFGHIQEFQHDQELQRIQERVKTFPS
CYP4A22 (NM_001010969) Human Over-expression Lysate
LC423245

USD 187.00

2 Weeks

CYP4A22 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CYP4A22 (NM_001010969) Human Over-expression Lysate
LY423245

USD 605.00

5 Days

Transient overexpression lysate of cytochrome P450, family 4, subfamily A, polypeptide 22 (CYP4A22)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CYP4A22 (NM_001010969) Human Untagged Clone
SC301547

USD 760.00

3 Weeks

CYP4A22 (untagged)-Human cytochrome P450, family 4, subfamily A, polypeptide 22 (CYP4A22)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
CYP4A22 ICC Control Block
TB424082

USD 1,070.00

4 Weeks

Transient overexpression of CYP4A22 (NM_001010969) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CYP4A22 Cytosection
TS424082

USD 225.00

4 Weeks

Transient overexpression of CYP4A22 (NM_001010969) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

CYP4A22 Cytosection
TS424082P5

USD 889.00

4 Weeks

Transient overexpression of CYP4A22 (NM_001010969) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack