ATP6V0D1 (Myc-DDK-tagged)-Human ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1 (ATP6V0D1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ATP6V0D1 (Myc-DDK-tagged)-Human ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1 (ATP6V0D1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1 (ATP6V0D1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF clone of Human ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1 (ATP6V0D1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ATP6V0D1 (Myc-DDK tagged) - Human ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1 (ATP6V0D1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1 (ATP6V0D1), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ATP6V0D1 (mGFP-tagged) - Human ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1 (ATP6V0D1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
ATP6V0D1 (GFP-tagged) - Human ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1 (ATP6V0D1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ATP6V0D1 (untagged)-Human ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1 (ATP6V0D1)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-ATP6V0D1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ATP6V0D1 antibody is: synthetic peptide directed towards the C-terminal region of Human ATP6V0D1. Synthetic peptide located within the following region: KLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQ |
Rabbit Polyclonal Anti-ATP6V0D1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ATP6V0D1 antibody is: synthetic peptide directed towards the C-terminal region of Human ATP6V0D1. Synthetic peptide located within the following region: GGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPE |
ATP6V0D1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1 (ATP6V0D1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
ATP6V0D1 MS Standard C13 and N15-labeled recombinant protein (NP_004682)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Transient overexpression of ATP6V0D1 (NM_004691) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ATP6V0D1 (NM_004691) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ATP6V0D1 (NM_004691) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack