Germany
Japan
United Kingdom
China
MYH10 (Myc-DDK-tagged)-Human myosin, heavy chain 10, non-muscle (MYH10)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table Download
MYH10 (Myc-DDK tagged) - Homo sapiens myosin, heavy chain 10, non-muscle (MYH10), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
MYH10 (Myc-DDK tagged) - Homo sapiens myosin, heavy chain 10, non-muscle (MYH10), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
MYH10 (GFP-tagged) - Human myosin, heavy chain 10, non-muscle (MYH10)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
MYH10 (GFP-tagged) - Homo sapiens myosin, heavy chain 10, non-muscle (MYH10), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
MYH10 (GFP-tagged) - Homo sapiens myosin, heavy chain 10, non-muscle (MYH10), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Transient overexpression lysate of myosin, heavy chain 10, non-muscle (MYH10)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Rabbit Polyclonal Anti-MYH10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MYH10 antibody: synthetic peptide directed towards the N terminal of human MYH10. Synthetic peptide located within the following region: WFPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCIIHYAGKVDYKAD |
MYH10 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
MYH10 (untagged)-Human myosin, heavy chain 10, non-muscle (MYH10)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
MYH10 (untagged) - Homo sapiens myosin, heavy chain 10, non-muscle (MYH10), transcript variant 1
| Vector | pCMV6 series |
| Tag | Tag Free |
MYH10 (untagged) - Homo sapiens myosin, heavy chain 10, non-muscle (MYH10), transcript variant 3
| Vector | pCMV6 series |
| Tag | Tag Free |
Transient overexpression of MYH10 (NM_005964) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MYH10 (NM_001256095) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MYH10 (NM_001256012) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MYH10 (NM_005964) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of MYH10 (NM_005964) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of MYH10 (NM_001256095) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of MYH10 (NM_001256012) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- MYH10
Pathways
- Viral myocarditis