Products

View as table Download

CSNK1A1L (Myc-DDK-tagged)-Human casein kinase 1, alpha 1-like (CSNK1A1L)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, CSNK1A1L (mGFP-tagged) - Human casein kinase 1, alpha 1-like (CSNK1A1L), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

CSNK1A1L (GFP-tagged) - Human casein kinase 1, alpha 1-like (CSNK1A1L)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human casein kinase 1, alpha 1-like (CSNK1A1L), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human casein kinase 1, alpha 1-like (CSNK1A1L), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human casein kinase 1, alpha 1-like (CSNK1A1L), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Recombinant protein of human casein kinase 1, alpha 1-like (CSNK1A1L), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli

CSNK1A1L (untagged)-Human casein kinase 1, alpha 1-like (CSNK1A1L)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit polyclonal anti-CKI-a1/L antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CKI-a1/L.

Lenti ORF clone of Human casein kinase 1, alpha 1-like (CSNK1A1L), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Rabbit Polyclonal Anti-CSNK1A1L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSNK1A1L antibody: synthetic peptide directed towards the middle region of human CSNK1A1L. Synthetic peptide located within the following region: TLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTQTGKQTEKNKNNVKD

CSNK1A1L HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of casein kinase 1, alpha 1-like (CSNK1A1L)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression of CSNK1A1L (NM_145203) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of CSNK1A1L (NM_145203) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of CSNK1A1L (NM_145203) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack