Products

cDNA Clones (14)
Proteins (12)
Antibodies (7)
Jump to Filters
View as table Download
Cyclin G (CCNG1) (NM_199246) Human Tagged ORF Clone
RC200001

USD 98.00

USD 470.00

In Stock

CCNG1 (Myc-DDK-tagged)-Human cyclin G1 (CCNG1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Cyclin G (CCNG1) (NM_004060) Human Tagged ORF Clone
RG221732

USD 460.00

In Stock

CCNG1 (GFP-tagged) - Human cyclin G1 (CCNG1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Cyclin G (CCNG1) (NM_004060) Human Tagged ORF Clone
RC221732

USD 420.00

In Stock

CCNG1 (Myc-DDK-tagged)-Human cyclin G1 (CCNG1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Cyclin G (CCNG1) (NM_199246) Human Tagged ORF Clone
RG200001

USD 460.00

In Stock

CCNG1 (GFP-tagged) - Human cyclin G1 (CCNG1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Cyclin G (CCNG1) (NM_199246) Human Tagged ORF Clone
RC200001L3

USD 768.00

3 Weeks

Lenti ORF clone of Human cyclin G1 (CCNG1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Cyclin G (CCNG1) (NM_199246) Human Tagged ORF Clone
RC200001L4

USD 768.00

3 Weeks

Lenti ORF clone of Human cyclin G1 (CCNG1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Cyclin G (CCNG1) (NM_004060) Human Tagged ORF Clone
RC221732L3

USD 620.00

3 Weeks

Lenti ORF clone of Human cyclin G1 (CCNG1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Cyclin G (CCNG1) (NM_004060) Human Tagged ORF Clone
RC221732L4

USD 620.00

3 Weeks

Lenti ORF clone of Human cyclin G1 (CCNG1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Cyclin G (CCNG1) (NM_004060) Human Untagged Clone
SC117605

USD 310.00

In Stock

CCNG1 (untagged)-Human cyclin G1 (CCNG1), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Cyclin G (CCNG1) Rabbit Polyclonal Antibody
TA347367

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-Cyclin G Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Cyclin G Antibody: A synthesized peptide derived from human Cyclin G
Cyclin G (CCNG1) (NM_199246) Human Untagged Clone
SC120847

USD 310.00

In Stock

CCNG1 (untagged)-Human cyclin G1 (CCNG1), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Cyclin G (CCNG1) Rabbit Polyclonal Antibody
TA313571

USD 345.00

4 Weeks

Rabbit polyclonal anti-Cyclin G antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Cyclin G.
Cyclin G (CCNG1) (C-term) Rabbit Polyclonal Antibody
AP50811PU-N

USD 450.00

2 Weeks

Cyclin G (CCNG1) (C-term) rabbit polyclonal antibody, Purified

Applications FC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 249-280 amino acids from the C-terminal region of human CCNG1
Cyclin G (CCNG1) (N-term) Rabbit Polyclonal Antibody
AP50812PU-N

USD 450.00

2 Weeks

Cyclin G (CCNG1) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 20-53 amino acids from the N-terminal region of human CCNG1
Cyclin G (CCNG1) (NM_199246) Human Recombinant Protein
TP710281

USD 425.00

In Stock

Purified recombinant protein of Human cyclin G1 (CCNG1), transcript variant 2, full length, with C-terminal DDK tag, expressed in sf9, 20ug

Tag C-DDK
Expression Host Sf9
Cyclin G (CCNG1) (NM_199246) Human Recombinant Protein
TP761429

USD 215.00

In Stock

Purified recombinant protein of Human cyclin G1 (CCNG1), transcript variant 2, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug

Tag N-GST and C-His
Expression Host E. coli
Cyclin G (CCNG1) (N-term) Rabbit Polyclonal Antibody
AP50813PU-N

USD 450.00

2 Weeks

Cyclin G (CCNG1) (N-term) rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 27-61 amino acids from the N-terminal region of human CCNG1
Cyclin G (CCNG1) Rabbit Polyclonal Antibody
TA330352

USD 375.00

5 Days

Rabbit Polyclonal Anti-CCNG1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CCNG1 antibody: synthetic peptide directed towards the N terminal of human CCNG1. Synthetic peptide located within the following region: IEVLTTTDSQKLLHQLNALLEQESRCQPKVCGLRLIESAHDNGLRMTARL
Cyclin G (CCNG1) Rabbit Polyclonal Antibody
TA354345

USD 355.00

5 Days

Rabbit anti Cyclin G1 Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to C-terminal of human cyclin G1. This sequence is identical to human, mouse and rat.
Cyclin G1 (1-295, His-tag) Human Protein
AR50156PU-N

USD 845.00

2 Weeks

Cyclin G1 (1-295, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli
Cyclin G1 (1-295, His-tag) Human Protein
AR50156PU-S

USD 330.00

2 Weeks

Cyclin G1 (1-295, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli
Cyclin G (CCNG1) (NM_199246) Human Over-expression Lysate
LC404314

USD 121.00

2 Weeks

CCNG1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Cyclin G (CCNG1) (NM_199246) Human Over-expression Lysate
LY404314

USD 396.00

5 Days

Transient overexpression lysate of cyclin G1 (CCNG1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Cyclin G (CCNG1) ICC Control Block
TB400001

USD 1,120.00

4 Weeks

Transient overexpression of CCNG1 (NM_199246) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Cyclin G (CCNG1) ICC Control Block
TB421732

USD 1,070.00

4 Weeks

Transient overexpression of CCNG1 (NM_004060) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Cyclin G (CCNG1) Cytosection
TS400001

USD 225.00

4 Weeks

Transient overexpression of CCNG1 (NM_199246) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Cyclin G (CCNG1) Cytosection
TS400001P5

USD 889.00

4 Weeks

Transient overexpression of CCNG1 (NM_199246) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Cyclin G (CCNG1) Cytosection
TS421732

USD 225.00

4 Weeks

Transient overexpression of CCNG1 (NM_004060) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Cyclin G (CCNG1) Cytosection
TS421732P5

USD 889.00

4 Weeks

Transient overexpression of CCNG1 (NM_004060) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack