CCNG1 (Myc-DDK-tagged)-Human cyclin G1 (CCNG1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CCNG1 (Myc-DDK-tagged)-Human cyclin G1 (CCNG1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CCNG1 (GFP-tagged) - Human cyclin G1 (CCNG1), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CCNG1 (Myc-DDK-tagged)-Human cyclin G1 (CCNG1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CCNG1 (GFP-tagged) - Human cyclin G1 (CCNG1), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human cyclin G1 (CCNG1), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,020.00
6 Weeks
Lenti ORF particles, CCNG1 (Myc-DDK tagged) - Human cyclin G1 (CCNG1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human cyclin G1 (CCNG1), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,020.00
6 Weeks
Lenti ORF particles, CCNG1 (mGFP-tagged) - Human cyclin G1 (CCNG1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human cyclin G1 (CCNG1), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, CCNG1 (Myc-DDK tagged) - Human cyclin G1 (CCNG1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human cyclin G1 (CCNG1), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, CCNG1 (mGFP-tagged) - Human cyclin G1 (CCNG1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CCNG1 (untagged)-Human cyclin G1 (CCNG1), transcript variant 1
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-Cyclin G Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Cyclin G Antibody: A synthesized peptide derived from human Cyclin G |
CCNG1 (untagged)-Human cyclin G1 (CCNG1), transcript variant 2
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit polyclonal anti-Cyclin G antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Cyclin G. |
Cyclin G (CCNG1) (C-term) rabbit polyclonal antibody, Purified
Applications | FC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 249-280 amino acids from the C-terminal region of human CCNG1 |
Cyclin G (CCNG1) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 20-53 amino acids from the N-terminal region of human CCNG1 |
Purified recombinant protein of Human cyclin G1 (CCNG1), transcript variant 2, full length, with C-terminal DDK tag, expressed in sf9, 20ug
Tag | C-DDK |
Expression Host | Sf9 |
Purified recombinant protein of Human cyclin G1 (CCNG1), transcript variant 2, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug
Tag | N-GST and C-His |
Expression Host | E. coli |
Cyclin G (CCNG1) (N-term) rabbit polyclonal antibody, Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 27-61 amino acids from the N-terminal region of human CCNG1 |
Rabbit Polyclonal Anti-CCNG1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CCNG1 antibody: synthetic peptide directed towards the N terminal of human CCNG1. Synthetic peptide located within the following region: IEVLTTTDSQKLLHQLNALLEQESRCQPKVCGLRLIESAHDNGLRMTARL |
Rabbit anti Cyclin G1 Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to C-terminal of human cyclin G1. This sequence is identical to human, mouse and rat. |
Cyclin G1 (1-295, His-tag) human recombinant protein, 0.25 mg
Tag | His-tag |
Expression Host | E. coli |
Cyclin G1 (1-295, His-tag) human recombinant protein, 50 µg
Tag | His-tag |
Expression Host | E. coli |
CCNG1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of cyclin G1 (CCNG1), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression of CCNG1 (NM_199246) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CCNG1 (NM_004060) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CCNG1 (NM_199246) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CCNG1 (NM_199246) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CCNG1 (NM_004060) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CCNG1 (NM_004060) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack