Products

Jump to Filters
View as table Download
RPS3A Rabbit Polyclonal Antibody
TA336162

USD 375.00

5 Days

Rabbit Polyclonal Anti-RPS3A Antibody

Applications WB
Reactivities Arabidopsis thaliana, Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RPS3A Antibody: synthetic peptide directed towards the N terminal of human RPS3A. Synthetic peptide located within the following region: APAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLADLQNDEVAFRKF