Products

Jump to Filters
View as table Download
Involucrin (IVL) Rabbit Polyclonal Antibody
TA314106

USD 345.00

In Stock

Rabbit polyclonal Involucrin antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Involucrin.
Involucrin (IVL) Rabbit Polyclonal Antibody
TA346741

USD 475.00

5 Days

Rabbit Polyclonal Anti-IVL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IVL antibody: synthetic peptide directed towards the N terminal of human IVL. Synthetic peptide located within the following region: AENPEQQLKQEKTQRDQQLNKQLEEEKKLLDQQLDQELVKRDEQLGMKKE
Involucrin (IVL) Rabbit Polyclonal Antibody
TA347407

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-Involucrin Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Involucrin Antibody: A synthesized peptide derived from human Involucrin
Involucrin (IVL) Mouse Monoclonal Antibody [Clone ID: SY5]
TA353276L

USD 1,140.00

2 Weeks

Mouse monoclonal Anti-Involucrin Clone SY5

Reactivities Human, Primate, Dog, Pig
Conjugation Unconjugated
Involucrin (IVL) Mouse Monoclonal Antibody [Clone ID: SY8]
TA353277L

USD 1,140.00

2 Weeks

Mouse monoclonal Anti-Involucrin Clone SY8

Reactivities Human, Primate, Dog, Pig
Conjugation Unconjugated
Involucrin (IVL) Rabbit Polyclonal Antibody
TA351501

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-IVL Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human IVL
Involucrin (IVL) Rabbit Polyclonal Antibody
TA377636

USD 220.00

3 Weeks

IVL Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 416-585 of human IVL (NP_005538.2).
Modifications Unmodified