Products

View as table Download

Rabbit Polyclonal Anti-RBL1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-RBL1 antibody: synthetic peptide directed towards the N terminal of human RBL1. Synthetic peptide located within the following region: FLDIFQNPYEEPPKLPRSRKQRRIPCSVKDLFNFCWTLFVYTKGNFRMIG

Rabbit Polyclonal Anti-RBL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RBL1 antibody: synthetic peptide directed towards the middle region of human RBL1. Synthetic peptide located within the following region: NTIYVGRVKSFALKYDLANQDHMMDAPPLSPFPHIKQQPGSPRRISQQHS

Carrier-free (BSA/glycerol-free) RBL1 mouse monoclonal antibody,clone OTI4E1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) RBL1 mouse monoclonal antibody,clone OTI4A10

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RBL1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human RBL1 (NP_002886.2).
Modifications Unmodified

Phospho-p107 (Thr369) Rabbit polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human RBL1 around the phosphorylation site of Thr369. AA range:335-384 (Phosphorylated)

RBL1 mouse monoclonal antibody,clone OTI4E1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RBL1 mouse monoclonal antibody,clone OTI4E1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RBL1 mouse monoclonal antibody,clone OTI4A10

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RBL1 mouse monoclonal antibody,clone OTI4A10

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated