Products

View as table Download

Rabbit Polyclonal Anti-RPL11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RPL11 antibody is: synthetic peptide directed towards the C-terminal region of Human RPL11. Synthetic peptide located within the following region: DFYVVLGRPGFSIADKKRRTGCIGAKHRISKEEAMRWFQQKYDGIILPGK

Rabbit polyclonal anti-RPL11 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human RPL11.

Rabbit Polyclonal Anti-RPL11 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human RPL11

RPL11 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-177 of human RPL11 (NP_001186731.1).
Modifications Unmodified