Products

Jump to Filters
View as table Download
RPS24 Rabbit Polyclonal Antibody
TA345744

USD 475.00

5 Days

Rabbit Polyclonal Anti-RPS24 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RPS24 antibody: synthetic peptide directed towards the middle region of human RPS24. Synthetic peptide located within the following region: GFGMIYDSLDYAKKNEPKHRLARHGLYEKKKTSRKQRKERKNRMKKVRGT
RPS24 Rabbit Polyclonal Antibody
TA381105

USD 220.00

3 Weeks

RPS24 Rabbit polyclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human RPS24 (NP_148982.1).
Modifications Unmodified