Products

View as table Download

Rabbit Polyclonal Anti-C15orf15 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C15orf15 antibody: synthetic peptide directed towards the middle region of human C15orf15. Synthetic peptide located within the following region: FIMNRLKKNKELQKVQDIKEVKQNIHLIRAPLAGKGKQLEEKMVQQLQED

Rabbit Polyclonal Anti-C15orf15 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C15orf15 antibody: synthetic peptide directed towards the middle region of human C15orf15. Synthetic peptide located within the following region: KCHKNFKKKRNPRKVRWTKAFRKAAGKELTVDNSFEFEKRRNEPIKYQRE

RSL24D1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human RLP24

RSL24D1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 10-80 of human RSL24D1 (NP_057388.1).
Modifications Unmodified