Products

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 20 of 20 results

(reset)

SFRS9 (SRSF9) Rabbit Polyclonal Antibody

TA345856

USD 475.00

5 Days

Rabbit Polyclonal Anti-SFRS9 Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-SFRS9 antibody: synthetic peptide directed towards the middle region of human SFRS9. Synthetic peptide located within the following region: VCYADVQKDGVGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYIRVYPER

SFRS9 (SRSF9) Mouse Monoclonal Antibody [Clone ID: OTI7F2]

CF808422

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SRSF9 mouse monoclonal antibody, clone OTI7F2 (formerly 7F2)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

SFRS9 (SRSF9) Mouse Monoclonal Antibody [Clone ID: OTI5G7]

CF808424

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SRSF9 mouse monoclonal antibody, clone OTI5G7 (formerly 5G7)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

SFRS9 (SRSF9) Mouse Monoclonal Antibody [Clone ID: OTI5A12]

CF808492

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SRSF9 mouse monoclonal antibody, clone OTI5A12 (formerly 5A12)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

SFRS9 (SRSF9) Rabbit Polyclonal Antibody

TA382023

USD 220.00

3 Weeks

SFRS9 Rabbit polyclonal Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-221 of human SFRS9 (NP_003760.1).
Modifications	Unmodified

SFRS9 (SRSF9) Rabbit Polyclonal Antibody

TA382024

USD 220.00

3 Weeks

SFRS9 Rabbit polyclonal Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-221 of human SFRS9 (NP_003760.1).
Modifications	Unmodified

SFRS9 (SRSF9) Rabbit Polyclonal Antibody

TA382025

USD 220.00

3 Weeks

SFRS9 Rabbit polyclonal Antibody

Applications	WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-221 of human SFRS9 (NP_003760.1).
Modifications	Unmodified

SFRS9 (SRSF9) Rabbit Polyclonal Antibody

TA382026

USD 220.00

3 Weeks

SFRS9 Rabbit polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-221 of human SFRS9 (NP_003760.1).
Modifications	Unmodified

SFRS9 (SRSF9) Mouse Monoclonal Antibody [Clone ID: OTI7F2]

TA808422

USD 379.00

In Stock

SRSF9 mouse monoclonal antibody, clone OTI7F2 (formerly 7F2)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

SFRS9 (SRSF9) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7F2]

TA808422AM

USD 420.00

4 Weeks

SRSF9 mouse monoclonal antibody, clone OTI7F2 (formerly 7F2), Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

SFRS9 (SRSF9) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7F2]

TA808422BM

USD 420.00

4 Weeks

SRSF9 mouse monoclonal antibody, clone OTI7F2 (formerly 7F2), HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

SFRS9 (SRSF9) Mouse Monoclonal Antibody [Clone ID: OTI7F2]

TA808422S

USD 159.00

2 Days

SRSF9 mouse monoclonal antibody, clone OTI7F2 (formerly 7F2)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

SFRS9 (SRSF9) Mouse Monoclonal Antibody [Clone ID: OTI5G7]

TA808424

USD 379.00

In Stock

SRSF9 mouse monoclonal antibody, clone OTI5G7 (formerly 5G7)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

Special Offer: Get a 15% discount on this product. Use code: "KO15".

SFRS9 (SRSF9) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5G7]

TA808424AM

USD 420.00

4 Weeks

SRSF9 mouse monoclonal antibody, clone OTI5G7 (formerly 5G7), Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 
• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

SFRS9 (SRSF9) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5G7]

TA808424BM

USD 420.00

4 Weeks

SRSF9 mouse monoclonal antibody, clone OTI5G7 (formerly 5G7), HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 
• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

SFRS9 (SRSF9) Mouse Monoclonal Antibody [Clone ID: OTI5G7]

TA808424S

USD 159.00

2 Days

SRSF9 mouse monoclonal antibody, clone OTI5G7 (formerly 5G7)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

SFRS9 (SRSF9) Mouse Monoclonal Antibody [Clone ID: OTI5A12]

TA808492

USD 379.00

In Stock

SRSF9 mouse monoclonal antibody, clone OTI5A12 (formerly 5A12)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

Special Offer: Get a 15% discount on this product. Use code: "KO15".

SFRS9 (SRSF9) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5A12]

TA808492AM

USD 420.00

4 Weeks

SRSF9 mouse monoclonal antibody, clone OTI5A12 (formerly 5A12), Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 
• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

SFRS9 (SRSF9) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5A12]

TA808492BM

USD 420.00

4 Weeks

SRSF9 mouse monoclonal antibody, clone OTI5A12 (formerly 5A12), HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 
• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

SFRS9 (SRSF9) Mouse Monoclonal Antibody [Clone ID: OTI5A12]

TA808492S

USD 159.00

2 Days

SRSF9 mouse monoclonal antibody, clone OTI5A12 (formerly 5A12)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

1 - 20 of 20 results