Products

Jump to Filters
View as table Download
TAF12 Rabbit Polyclonal Antibody
TA330160

USD 375.00

5 Days

Rabbit Polyclonal Anti-TAF12 Antibody

Applications Assay, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TAF12 antibody: synthetic peptide directed towards the N terminal of human TAF12. Synthetic peptide located within the following region: MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRL
TAF12 Rabbit Polyclonal Antibody
TA350479

USD 345.00

In Stock

Rabbit Polyclonal Anti-TAF12 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human TAF12
TAF12 Rabbit Polyclonal Antibody
TA365054

USD 380.00

4 Weeks

TAF12 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human TAF12
TAF12 Rabbit Polyclonal Antibody
TA382277

USD 220.00

3 Weeks

TAF12 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-161 of human TAF12 (NP_001128690.1).
Modifications Unmodified