Products

View as table Download

Rabbit Polyclonal Anti-TAF4 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TAF4 Antibody: A synthesized peptide derived from human TAF4

Rabbit polyclonal anti-TAF4 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TAF4.

Rabbit Polyclonal Anti-TAF4 Antibody

Applications 10k-ChIP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TAF4 Antibody: synthetic peptide directed towards the middle region of human TAF4. Synthetic peptide located within the following region: EQASDVRAQLKFFEQLDQIEKQRKDEQEREILMRAAKSRSRQEDPEQLRL

TAF4 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human TAF4