Products

Jump to Filters
View as table Download
Alpha Dystroglycan (DAG1) Goat Polyclonal Antibody
TA311294

USD 375.00

5 Days

Goat Anti-DAG1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-HVGKHEYFMHATDK, from the internal region of the protein sequence according to NP_004384.3.
Dag1 Rabbit Polyclonal Antibody
TA339412

USD 375.00

5 Days

Rabbit Polyclonal Anti-Dag1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Dag1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PPSPGSSAAPATEVPDRDPEKSSEDDVYLHTVIPAVVVAAILLIAGIIAM
Alpha Dystroglycan (DAG1) Rabbit Polyclonal Antibody
TA375317

USD 275.00

3 Weeks

DAG1 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 654-749 of human DAG1 (NP_004384.4).
Modifications Unmodified
Phospho-DAG1 (pTyr892) Mouse Antibody [Clone ID: M117]
TA389114

USD 385.00

5 Days

Anti-β-Dystroglycan (Tyr-892), Phosphospecific Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated