Germany
Japan
United Kingdom
China
Products
View as table Download
Rabbit Polyclonal Anti-Connexin 32 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Connexin 32 Antibody: A synthesized peptide derived from human Connexin 32 |
Rabbit Polyclonal Anti-GJB1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GJB1 antibody: synthetic peptide directed towards the middle region of human GJB1. Synthetic peptide located within the following region: RACARRAQRRSNPPSRKGSGFGHRLSPEYKQNEINKLLSEQDGSLKDILR |
Rabbit Polyclonal Anti-GJB1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GJB1 antibody: synthetic peptide directed towards the C terminal of human GJB1. Synthetic peptide located within the following region: GFGHRLSPEYKQNEINKLLSEQDGSLKDILRRSPGTGAGLAEKSDRCSAC |
Mouse monoclonal Anti-Cx32 Clone Connexin32
| Reactivities | Chicken, Human, Mouse, Rat |
| Conjugation | Unconjugated |
GJB1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 214-283 of human GJB1 (NP_000157.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- GJB1
Reactivities
- Mouse