Products

View as table Download

Goat Polyclonal Antibody against MAX

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-EEPQSRKKLRMEAS, from the C Terminus of the protein sequence according to NP_002373.

Anti-MAX Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Rabbit Polyclonal Anti-MAX Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-MAX Antibody: synthetic peptide directed towards the middle region of human MAX. Synthetic peptide located within the following region: LQTNYPSSDNSLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS

Carrier-free (BSA/glycerol-free) MAX mouse monoclonal antibody,clone OTI14G1

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MAX mouse monoclonal antibody,clone OTI5F5

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated

MAX Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-1-160 of human MAX (NP_002373.3).
Modifications Unmodified

MAX mouse monoclonal antibody,clone OTI14G1

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated

MAX mouse monoclonal antibody,clone OTI14G1

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated

MAX mouse monoclonal antibody,clone OTI5F5

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated

MAX mouse monoclonal antibody,clone OTI5F5

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated