Products

View as table Download

Rabbit Polyclonal Anti-NODAL Antibody - N-terminal region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NODAL antibody: synthetic peptide directed towards the N terminal of human NODAL. Synthetic peptide located within the following region: PSSPSPLAYMLSLYRDPLPRADIIRSLQAEDVAVDGQNWTFAFDFSFLSQ

Rabbit Monoclonal Antibody against NODAL (Clone EP2058Y)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated

Goat Anti-NODAL Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence ECPNPVGEEFH, from the internal region of the protein sequence according to NP_060525.2.