Germany
Japan
United Kingdom
China
Anti-SOX1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 378-391 amino acids of human SRY (sex determining region Y)-box 1 |
Products
View as table Download
Rabbit polyclonal anti-Sox-1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to residues surrounding amino acids 322 of mouse Sox-1 |
Rabbit Polyclonal anti-SOX1 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOX1 antibody: synthetic peptide directed towards the middle region of human SOX1. Synthetic peptide located within the following region: AAGGAHQNSAVAAAAAAAAASSGALGALGSLVKSEPSGSPPAPAHSRAPC |
Rabbit Polyclonal Anti-SOX1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOX1 antibody: synthetic peptide directed towards the N terminal of human SOX1. Synthetic peptide located within the following region: GGGAKANQDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWK |
Rabbit Polyclonal Anti-SOX1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOX1 antibody: synthetic peptide directed towards the middle region of human SOX1. Synthetic peptide located within the following region: REMISMYLPAGEGGDPAAAAAAAAQSRLHSLPQHYQGAGAGVNGTVPLTH |
Rabbit anti SOX-1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from N-terminus of Human SOX-1 protein. This sequence is identical among human and mouse. |
Anti-SOX1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 378-391 amino acids of human SRY (sex determining region Y)-box 1 |
SOX1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human SOX1 |
| Modifications | Unmodified |
Active filters
Target Symbol
- SOX1
Reactivities
- Mouse