Products

Jump to Filters
View as table Download
Taf12 Rabbit Polyclonal Antibody
TA329242

USD 375.00

5 Days

Rabbit Polyclonal anti-Taf12 antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Taf12 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: EVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK
TAF12 Rabbit Polyclonal Antibody
TA350479

USD 345.00

In Stock

Rabbit Polyclonal Anti-TAF12 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human TAF12
TAF12 Rabbit Polyclonal Antibody
TA365054

USD 380.00

4 Weeks

TAF12 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human TAF12