Products

View as table Download

Rabbit Polyclonal Anti-ASPH Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ASPH antibody: synthetic peptide directed towards the middle region of human ASPH. Synthetic peptide located within the following region: PEEAEPHTEPEEQVPVEAEPQNIEDEAKEQIQSLLHEMVHAEHVEGEDLQ

Rabbit Polyclonal Anti-ASPH

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ASPH antibody: synthetic peptide directed towards the N terminal of human ASPH. Synthetic peptide located within the following region: SEVLQGKLGIYDADGDGDFDVDDAKVLLEGPSGVAKRKTKAKVKELTKEE

Aspartate beta hydroxylase (ASPH) (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 301-331 amino acids from the Central region of human ASPH

Rabbit Polyclonal Anti-ASPH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ASPH Antibody: synthetic peptide directed towards the middle region of human ASPH. Synthetic peptide located within the following region: PVEDSQVIVEEVSIFPVEEQQEVPPETNRKTDDPEQKAKVKKKKPKLLNK

Rabbit Polyclonal Anti-ASPH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ASPH Antibody: synthetic peptide directed towards the middle region of human ASPH. Synthetic peptide located within the following region: ETNRKTDDPEQKAKVKKKKPKLLNKFDKTIKAELDAAEKLRKRGKIEEAV

Rabbit Polyclonal Anti-ASPH

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ASPH antibody: synthetic peptide directed towards the N terminal of human ASPH. Synthetic peptide located within the following region: MAEDKETKHGGHKNGRKGGLSGTSFFTWFMVIALLGVWTSVAVVWFDLVD

Rabbit Polyclonal Anti-ASPH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ASPH antibody: synthetic peptide directed towards the N terminal of human ASPH. Synthetic peptide located within the following region: MAQRKNAKSSGNSSSSGSGSGSTSAGSSSPGARRETKHGGHKNGRKGGLS

ASPH Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 111-270 of human ASPH (NP_001158227.1).
Modifications Unmodified