Products

cDNA Clones (21)
RNAi (12)
Gene Expression (7)
Primary Antibodies (6)
Proteins (5)
Jump to Filters
View as table Download
Cacng3 Rabbit Polyclonal Antibody
TA328765

USD 585.00

3 Weeks

Rabbit Polyclonal Anti-CaVgamma3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)RSHSELLKKSTFAR, corresponding to amino acid residues 210-223 of rat CaV?3. Intracellular, C-terminus.
CACNG3 Rabbit Polyclonal Antibody
TA338562

USD 375.00

5 Days

Rabbit Polyclonal Anti-Cacng3 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Cacng3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GDPGQRDSKKSYSYGWSFYFGAFSFIIAEIVGVVAVHIYIEKHQQLRARS
Cacng3 Rabbit Polyclonal Antibody
TA360325

USD 360.00

5 Days

CACNG3 Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CACNG3
CACNG3 Rabbit Polyclonal Antibody
TA365569

USD 380.00

4 Weeks

CACNG3 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
CACNG3 Rabbit Polyclonal Antibody
TA369892

USD 380.00

4 Weeks

CACNG3 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
CACNG3 Rabbit Polyclonal Antibody
TA383845

USD 380.00

4 Weeks

CACNG3 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic Peptide of CACNG3