Products

cDNA Clones (35)
Proteins (17)
Primary Antibodies (4)
RNAi (4)
Gene Expression (3)
Jump to Filters
View as table Download
CYP3A43 Rabbit Polyclonal Antibody
TA315747

USD 345.00

4 Weeks

Rabbit polyclonal Cytochrome P450 3A43 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 3A43.
CYP3A43 Rabbit Polyclonal Antibody
TA338621

USD 375.00

5 Days

Rabbit Polyclonal Anti-CYP3A43 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP3A43 antibody: synthetic peptide directed towards the middle region of human CYP3A43. Synthetic peptide located within the following region: ERMKESRLKDKQKHRVDFFQQMIDSQNSKETKSHKALSDLELVAQSIIII
CYP3A43 Rabbit Polyclonal Antibody
TA338622

USD 375.00

5 Days

Rabbit Polyclonal Anti-CYP3A43 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP3A43 antibody: synthetic peptide directed towards the C terminal of human CYP3A43. Synthetic peptide located within the following region: IYALHHDPKYWTEPEKFCPESRFSKKNKDSIDLYRYIPFGAGPRNCIGMR
CYP3A43 Rabbit Polyclonal Antibody
TA370047

USD 380.00

4 Weeks

CYP3A43 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CYP3A43