Rabbit Polyclonal Anti-EPHB3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EPHB3 antibody is: synthetic peptide directed towards the C-terminal region of Human EPHB3. Synthetic peptide located within the following region: QLQEQLPLIVGSATAGLVFVVAVVVIAIVCLRKQRHGSDSEYTEKLQQYI |
Eph receptor B3 (EPHB3) Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 270-560 of human Eph receptor B3 (Eph receptor B3 (EPHB3)) (NP_004434.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
