Products

View as table Download

GFRAL (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 366-394 amino acids from the C-terminal region of human GFRAL

Rabbit Polyclonal Anti-GFRAL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GFRAL Antibody is: synthetic peptide directed towards the N-terminal region of Human GFRAL. Synthetic peptide located within the following region: TDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVA