Products

cDNA Clones (24)
RNAi (12)
Gene Expression (6)
Proteins (5)
Primary Antibodies (2)
Jump to Filters
View as table Download
PRODH2 Rabbit Polyclonal Antibody
TA346138

USD 475.00

5 Days

Rabbit Polyclonal Anti-PRODH2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRODH2 antibody: synthetic peptide directed towards the C terminal of human PRODH2. Synthetic peptide located within the following region: LGIPLDGTVCFGQLLGMCDHVSLALGQAGYVVYKSIPYGSLEEVIPYLIR
PRODH2 (Center) Rabbit Polyclonal Antibody
AP53449PU-N

USD 450.00

2 Weeks

PRODH2 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 171-200 amino acids from the Central region of human PRODH2