Products

cDNA Clones (23)
RNAi (12)
Gene Expression (6)
Proteins (4)
Antibodies (1)
Jump to Filters
View as table Download
ABCA5 (NM_018672) Human Tagged ORF Clone
RC213865

USD 1,720.00

2 Weeks

ABCA5 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family A (ABC1), member 5 (ABCA5), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Abca5 (NM_147219) Mouse Tagged ORF Clone
MR222272

USD 1,270.00

In Stock

Abca5 (Myc-DDK-tagged) - Mouse ATP-binding cassette, sub-family A (ABC1), member 5 (Abca5)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ABCA5 Human Gene Knockout Kit (CRISPR)
KN413865

USD 1,290.00

2 Weeks

ABCA5 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN413865 is the updated version of KN213865.
Abca5 Mouse Gene Knockout Kit (CRISPR)
KN500606

USD 1,290.00

2 Weeks

Abca5 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN500606 is the updated version of KN300606.
Abca5 (NM_147219) Mouse Tagged ORF Clone
MG222272

USD 1,400.00

3 Weeks

Abca5 (GFP-tagged) - Mouse ATP-binding cassette sub-family A (ABC1) member 5 (Abca5), (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Abca5 (NM_147219) Mouse Tagged ORF Clone
MR222272L3

USD 1,470.00

3 Weeks

Lenti ORF clone of Abca5 (Myc-DDK-tagged) - Mouse ATP-binding cassette, sub-family A (ABC1), member 5 (Abca5)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Abca5 (NM_147219) Mouse Tagged ORF Clone Lentiviral Particle
MR222272L3V

USD 1,670.00

6 Weeks

Lenti ORF particles, Abca5 (Myc-DDK-tagged) - Mouse ATP-binding cassette, sub-family A (ABC1), member 5 (Abca5), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Abca5 (NM_147219) Mouse Tagged ORF Clone
MR222272L4

USD 1,470.00

3 Weeks

Lenti ORF clone of Abca5 (mGFP-tagged) - Mouse ATP-binding cassette, sub-family A (ABC1), member 5 (Abca5)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Abca5 (NM_147219) Mouse Tagged ORF Clone Lentiviral Particle
MR222272L4V

USD 1,670.00

6 Weeks

Lenti ORF particles, Abca5 (GFP-tagged) - Mouse ATP-binding cassette, sub-family A (ABC1), member 5 (Abca5), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ABCA5 (NM_018672) Human Tagged ORF Clone
RC213865L3

USD 1,920.00

10 Weeks

Lenti-ORF clone of ABCA5 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family A (ABC1), member 5 (ABCA5), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ABCA5 (NM_018672) Human Tagged ORF Clone Lentiviral Particle
RC213865L3V

USD 2,120.00

13 Weeks

Lenti ORF particles, ABCA5 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family A (ABC1), member 5 (ABCA5), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ABCA5 (NM_018672) Human Tagged ORF Clone
RC213865L4

USD 1,920.00

10 Weeks

Lenti-ORF clone of ABCA5 (mGFP-tagged)-Human ATP-binding cassette, sub-family A (ABC1), member 5 (ABCA5), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ABCA5 (NM_018672) Human Tagged ORF Clone Lentiviral Particle
RC213865L4V

USD 2,120.00

13 Weeks

Lenti ORF particles, ABCA5 (mGFP-tagged)-Human ATP-binding cassette, sub-family A (ABC1), member 5 (ABCA5), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ABCA5 (NM_172232) Human Tagged ORF Clone
RC220098

USD 1,720.00

7 Weeks

ABCA5 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family A (ABC1), member 5 (ABCA5), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ABCA5 (NM_172232) Human Tagged ORF Clone
RC220098L3

USD 1,920.00

10 Weeks

Lenti-ORF clone of ABCA5 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family A (ABC1), member 5 (ABCA5), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ABCA5 (NM_172232) Human Tagged ORF Clone Lentiviral Particle
RC220098L3V

USD 2,120.00

13 Weeks

Lenti ORF particles, ABCA5 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family A (ABC1), member 5 (ABCA5), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ABCA5 (NM_172232) Human Tagged ORF Clone
RC220098L4

USD 1,920.00

10 Weeks

Lenti-ORF clone of ABCA5 (mGFP-tagged)-Human ATP-binding cassette, sub-family A (ABC1), member 5 (ABCA5), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ABCA5 (NM_172232) Human Tagged ORF Clone Lentiviral Particle
RC220098L4V

USD 2,120.00

13 Weeks

Lenti ORF particles, ABCA5 (mGFP-tagged)-Human ATP-binding cassette, sub-family A (ABC1), member 5 (ABCA5), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ABCA5 (NM_018672) Human Tagged ORF Clone
RG213865

USD 1,890.00

7 Weeks

ABCA5 (GFP-tagged) - Human ATP-binding cassette, sub-family A (ABC1), member 5 (ABCA5), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ABCA5 (NM_172232) Human Tagged ORF Clone
RG220098

USD 1,890.00

7 Weeks

ABCA5 (GFP-tagged) - Human ATP-binding cassette, sub-family A (ABC1), member 5 (ABCA5), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Abca5 (NM_173307) Rat Tagged ORF Clone
RR203757

USD 2,780.00

8 Weeks

Abca5 (Myc-DDK-tagged ORF) - Rat ATP-binding cassette, sub-family A (ABC1), member 5 (Abca5), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ABCA5 (NM_172232) Human Untagged Clone
SC306747

USD 3,340.00

In Stock

ABCA5 (untagged)-Human ATP-binding cassette, sub-family A (ABC1), member 5 (ABCA5), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
ABCA5 Rabbit Polyclonal Antibody
TA331848

USD 375.00

5 Days

Rabbit Polyclonal Anti-ABCA5 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABCA5 Antibody: synthetic peptide directed towards the C terminal of human ABCA5. Synthetic peptide located within the following region: HKEYDDKKDFLLSRKVKKVATKYISFCVKKGEILGLLGPNGAGKSTIINI
Human ABCA5 activation kit by CRISPRa
GA108321

USD 1,290.00

2 Weeks

ABCA5 CRISPRa kit - CRISPR gene activation of human ATP binding cassette subfamily A member 5

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Abca5 activation kit by CRISPRa
GA213450

USD 1,290.00

2 Weeks

Abca5 CRISPRa kit - CRISPR gene activation of mouse ATP-binding cassette, sub-family A (ABC1), member 5

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
ABCA5 Human qPCR Primer Pair (NM_018672)
HP213195

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene ABCA5

Abca5 (NM_147219) Mouse Untagged Clone
MC224780

USD 2,210.00

7 Weeks

Abca5 (untagged) - Mouse ATP-binding cassette, sub-family A (ABC1), member 5 (Abca5), (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Abca5 Mouse qPCR Primer Pair (NM_147219)
MP201124

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Abca5

Abca5 (NM_173307) Rat Untagged Clone
RN203757

USD 2,780.00

8 Weeks

Abca5 (untagged ORF) - Rat ATP-binding cassette, sub-family A (ABC1), member 5 (Abca5), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
ABCA5 (NM_018672) Human Untagged Clone
SC309638

USD 3,340.00

4 Weeks

ABCA5 (untagged)-Human ATP-binding cassette, sub-family A (ABC1), member 5 (ABCA5), transcript variant 1

Vector pCMV6 series
Tag Tag Free
ABCA5 Human siRNA Oligo Duplex (Locus ID 23461)
SR308289

USD 430.00

2 Weeks

ABCA5 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Abca5 Mouse siRNA Oligo Duplex (Locus ID 217265)
SR423093

USD 430.00

2 Weeks

Abca5 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).
Abca5 Rat siRNA Oligo Duplex (Locus ID 286970)
SR503471

USD 430.00

2 Weeks

Abca5 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

ABCA5 (NM_018672) ICC Control Block
TB413865

USD 2,370.00

4 Weeks

Transient overexpression of ABCA5 (NM_018672) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ABCA5 (NM_172232) ICC Control Block
TB420098

USD 2,370.00

4 Weeks

Transient overexpression of ABCA5 (NM_172232) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ABCA5 Human shRNA Plasmid Kit (Locus ID 23461)
TL306925

USD 815.00

2 Weeks

ABCA5 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
ABCA5 Human shRNA Lentiviral Particle (Locus ID 23461)
TL306925V

USD 1,395.00

5 Weeks

ABCA5 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Format Lentiviral particles
Vector pGFP-C-shLenti
Abca5 Mouse shRNA Plasmid (Locus ID 217265)
TL510810

USD 815.00

2 Weeks

Abca5 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
Abca5 Mouse shRNA Lentiviral Particle (Locus ID 217265)
TL510810V

USD 1,395.00

5 Weeks

Abca5 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Format Lentiviral particles
Vector pGFP-C-shLenti
Abca5 Rat shRNA Plasmid (Locus ID 286970)
TL713389

USD 815.00

2 Weeks

Abca5 - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
Abca5 Rat shRNA Lentiviral Particle (Locus ID 286970)
TL713389V

USD 1,395.00

5 Weeks

Abca5 - Rat shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Format Lentiviral particles
Vector pGFP-C-shLenti
ABCA5 Human shRNA Plasmid Kit (Locus ID 23461)
TR306925

USD 715.00

2 Weeks

ABCA5 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS
Abca5 Mouse shRNA Plasmid (Locus ID 217265)
TR510810

USD 715.00

2 Weeks

Abca5 - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS
Abca5 Rat shRNA Plasmid (Locus ID 286970)
TR713389

USD 715.00

2 Weeks

Abca5 - Rat, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS
ABCA5 ICC Control Sections
TS413865P5

USD 889.00

4 Weeks

Transient overexpression of ABCA5 (NM_018672) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

ABCA5 ICC Control Sections
TS420098P5

USD 889.00

4 Weeks

Transient overexpression of ABCA5 (NM_172232) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack