CYP2W1 (Myc-DDK-tagged)-Human cytochrome P450, family 2, subfamily W, polypeptide 1 (CYP2W1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CYP2W1 (Myc-DDK-tagged)-Human cytochrome P450, family 2, subfamily W, polypeptide 1 (CYP2W1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human cytochrome P450, family 2, subfamily W, polypeptide 1 (CYP2W1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, CYP2W1 (Myc-DDK tagged) - Human cytochrome P450, family 2, subfamily W, polypeptide 1 (CYP2W1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, CYP2W1 (mGFP-tagged) - Human cytochrome P450, family 2, subfamily W, polypeptide 1 (CYP2W1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Cyp2w1 (Myc-DDK-tagged) - Mouse cytochrome P450, family 2, subfamily w, polypeptide 1 (Cyp2w1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CYP2W1 (GFP-tagged) - Human cytochrome P450, family 2, subfamily W, polypeptide 1 (CYP2W1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CYP2W1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Cyp2w1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Cyp2w1 (GFP-tagged) - Mouse cytochrome P450 family 2 subfamily w polypeptide 1 (Cyp2w1), (10ug)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Cyp2w1 (Myc-DDK-tagged) - Mouse cytochrome P450, family 2, subfamily w, polypeptide 1 (Cyp2w1)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Cyp2w1 (Myc-DDK-tagged) - Mouse cytochrome P450, family 2, subfamily w, polypeptide 1 (Cyp2w1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Cyp2w1 (mGFP-tagged) - Mouse cytochrome P450, family 2, subfamily w, polypeptide 1 (Cyp2w1)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Cyp2w1 (GFP-tagged) - Mouse cytochrome P450, family 2, subfamily w, polypeptide 1 (Cyp2w1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human cytochrome P450, family 2, subfamily W, polypeptide 1 (CYP2W1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CYP2W1 (Myc-DDK tagged) - Human cytochrome P450, family 2, subfamily W, polypeptide 1 (CYP2W1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human cytochrome P450, family 2, subfamily W, polypeptide 1 (CYP2W1), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CYP2W1 (mGFP-tagged) - Human cytochrome P450, family 2, subfamily W, polypeptide 1 (CYP2W1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human cytochrome P450, family 2, subfamily W, polypeptide 1 (CYP2W1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Cyp2w1 (untagged) - Mouse cytochrome P450, family 2, subfamily w, polypeptide 1 (Cyp2w1), (10ug)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human cytochrome P450, family 2, subfamily W, polypeptide 1 (CYP2W1), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit polyclonal Cytochrome P450 2W1 antibody
Applications | IF, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2W1. |
CYP2W1 (untagged)-Human cytochrome P450, family 2, subfamily W, polypeptide 1 (CYP2W1)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
CYP2W1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of cytochrome P450, family 2, subfamily W, polypeptide 1 (CYP2W1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-CYP2W1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP2W1 antibody: synthetic peptide directed towards the C terminal of human CYP2W1. Synthetic peptide located within the following region: PVCSYVDALIQQGQGDDPEGLFAEANAVACTLDMVMAGTETTSATLQWAA |
CYP2W1 CRISPRa kit - CRISPR gene activation of human cytochrome P450 family 2 subfamily W member 1
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Cyp2w1 CRISPRa kit - CRISPR gene activation of mouse cytochrome P450, family 2, subfamily w, polypeptide 1
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene CYP2W1
Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene CYP2W1
CYP2W1 MS Standard C13 and N15-labeled recombinant protein (NP_060251)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
CYP2W1 (untagged)-Human cytochrome P450, family 2, subfamily W, polypeptide 1 (CYP2W1)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
CYP2W1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Cyp2w1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Rabbit Polyclonal Anti-CYP2W1 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CYP2W1 |
CYP2W1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CYP2W1 |
CYP2W1 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 141-490 of human CYP2W1 (NP_060251.2). |
Modifications | Unmodified |
Transient overexpression of CYP2W1 (NM_017781) in HEK293T cells paraffin embedded controls for ICC/IHC staining
CYP2W1 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
Format | Lentiviral plasmids |
Vector | pGFP-C-shLenti |
CYP2W1 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
Format | Lentiviral particles |
Vector | pGFP-C-shLenti |
Purified recombinant protein of Mouse cytochrome P450, family 2, subfamily w, polypeptide 1 (Cyp2w1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Tag | C-MYC/DDK |
Expression Host | HEK293T |
CYP2W1 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
Format | Retroviral plasmids |
Vector | pRS |
Transient overexpression of CYP2W1 (NM_017781) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CYP2W1 (NM_017781) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack