Germany
Japan
United Kingdom
China
MAP3K1 (Myc-DDK-tagged)-Human mitogen-activated protein kinase kinase kinase 1 (MAP3K1)
| Vector | pCMV6-AC-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table Download
USD 1,990.00
6 Weeks
Lenti ORF particles, MAP3K1 (Myc-DDK-tagged)-Human mitogen-activated protein kinase kinase kinase 1 (MAP3K1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 1,990.00
3 Weeks
Lenti ORF particles, MAP3K1 (mGFP-tagged)-Human mitogen-activated protein kinase kinase kinase 1 (MAP3K1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Map3k1 (Myc-DDK-tagged) - Mouse mitogen-activated protein kinase kinase kinase 1 (Map3k1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Map3k1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN509726 is the updated version of KN309726.
Map3k1 (GFP-tagged) - Mouse mitogen-activated protein kinase kinase kinase 1 (Map3k1), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Map3k1 (Myc-DDK-tagged) - Mouse mitogen-activated protein kinase kinase kinase 1 (Map3k1)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Map3k1 (Myc-DDK-tagged) - Mouse mitogen-activated protein kinase kinase kinase 1 (Map3k1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Map3k1 (mGFP-tagged) - Mouse mitogen-activated protein kinase kinase kinase 1 (Map3k1)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Map3k1 (GFP-tagged) - Mouse mitogen-activated protein kinase kinase kinase 1 (Map3k1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of MAP3K1 (Myc-DDK-tagged)-Human mitogen-activated protein kinase kinase kinase 1 (MAP3K1)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 1,990.00
7 Weeks
Lenti ORF particles, MAP3K1 (Myc-DDK-tagged)-Human mitogen-activated protein kinase kinase kinase 1 (MAP3K1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of MAP3K1 (mGFP-tagged)-Human mitogen-activated protein kinase kinase kinase 1 (MAP3K1)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 1,990.00
5 Weeks
Lenti ORF particles, MAP3K1 (mGFP-tagged)-Human mitogen-activated protein kinase kinase kinase 1 (MAP3K1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
MAP3K1 (GFP-tagged) - Human mitogen-activated protein kinase kinase kinase 1 (MAP3K1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Map3k1 (Myc-DDK-tagged ORF) - Rat mitogen activated protein kinase kinase kinase 1 (Map3k1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
MAP3K1 (untagged)-Human mitogen-activated protein kinase kinase kinase 1 (MAP3K1)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
MAP3K1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Rabbit polyclonal MAP3K1 (Thr1402) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MAP3K1 around the phosphorylation site of threonine 1402 (K-G-TP-G-A). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-MAP3K1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAP3K1 antibody: synthetic peptide directed towards the C terminal of human MAP3K1. Synthetic peptide located within the following region: LGAFSSCYQAQDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMSH |
Lenti-ORF clone of MAP3K1 (Myc-DDK-tagged)-Human mitogen-activated protein kinase kinase kinase 1 (MAP3K1)
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
MAP3K1 (untagged)-Kinase deficient mutant (K1108M) of Human mitogen-activated protein kinase kinase kinase 1 (MAP3K1)
| Vector | pCMV6-XL6 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Map3k1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Rabbit polyclonal anti-MAP3K1 antibody
| Applications | IF |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MAP3K1. |
MAP3K1 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
MAP3K1 - Human, 4 unique 29mer shRNA constructs in retroviral RFP vector
| Format | Retroviral plasmids |
| Vector | pRFP-C-RS |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
qSTAR qPCR primer pairs against Homo sapiens gene MAP3K1
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Rabbit anti Mekk-1 Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
MAP3K1 CRISPRa kit - CRISPR gene activation of human mitogen-activated protein kinase kinase kinase 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Map3k1 CRISPRa kit - CRISPR gene activation of mouse mitogen-activated protein kinase kinase kinase 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Map3k1 (untagged) - Mouse mitogen-activated protein kinase kinase kinase 1 (Map3k1), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Map3k1
MAP3K1 MS Standard C13 and N15-labeled recombinant protein (NP_005912)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Map3k1 (untagged ORF) - Rat mitogen activated protein kinase kinase kinase 1 (Map3k1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Map3k1 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
MAP3K1 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1400 to the C-terminus of human MAP3K1 (NP_005912.1). |
| Modifications | Unmodified |
Transient overexpression of MAP3K1 (NM_005921) in HEK293T cells paraffin embedded controls for ICC/IHC staining
MAP3K1 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Map3k1 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Map3k1 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Map3k1 - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Map3k1 - Rat shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Purified recombinant protein of Mouse mitogen-activated protein kinase kinase kinase 1 (Map3k1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
| Tag | C-MYC/DDK |
| Expression Host | HEK293T |
MAP3K1 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
| E. coli Selection | Ampicillin |
| Mammalian Cell Selection | Puromycin |
Map3k1 - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Map3k1 - Rat, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Transient overexpression of MAP3K1 (NM_005921) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of MAP3K1 (NM_005921) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- MAP3K1