Products

cDNA Clones (51)
Proteins (17)
RNAi (11)
Gene Expression (7)
Antibodies (3)
Jump to Filters
View as table Download
LENG4 (MBOAT7) (NM_024298) Human Tagged ORF Clone Lentiviral Particle
RC201320L4V

USD 1,020.00

3 Weeks

Lenti ORF particles, MBOAT7 (mGFP-tagged) - Human membrane bound O-acyltransferase domain containing 7 (MBOAT7), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
LENG4 (MBOAT7) (NM_024298) Human Tagged ORF Clone
RC201320

USD 420.00

In Stock

MBOAT7 (Myc-DDK-tagged)-Human membrane bound O-acyltransferase domain containing 7 (MBOAT7), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
LENG4 (MBOAT7) (NM_001146082) Human Tagged ORF Clone
RC228833

USD 420.00

In Stock

MBOAT7 (Myc-DDK-tagged)-Human membrane bound O-acyltransferase domain containing 7 (MBOAT7), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
LENG4 (MBOAT7) (NM_024298) Human Recombinant Protein
TP301320

USD 823.00

In Stock

Recombinant protein of human membrane bound O-acyltransferase domain containing 7 (MBOAT7)

Tag C-Myc/DDK
Expression Host HEK293T
Mboat7 (NM_029934) Mouse Tagged ORF Clone
MR207548

USD 350.00

In Stock

Mboat7 (Myc-DDK-tagged) - Mouse membrane bound O-acyltransferase domain containing 7 (Mboat7)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
LENG4 (MBOAT7) (NM_024298) Human Tagged ORF Clone Lentiviral Particle
RC201320L1V

USD 820.00

3 Weeks

Lenti ORF particles, MBOAT7 (Myc-DDK tagged) - Human membrane bound O-acyltransferase domain containing 7 (MBOAT7), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
LENG4 (MBOAT7) (NM_024298) Human Tagged ORF Clone Lentiviral Particle
RC201320L2V

USD 820.00

6 Weeks

Lenti ORF particles, MBOAT7 (mGFP-tagged) - Human membrane bound O-acyltransferase domain containing 7 (MBOAT7), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
LENG4 (MBOAT7) (NM_001146082) Human Tagged ORF Clone Lentiviral Particle
RC228833L2V

USD 820.00

6 Weeks

Lenti ORF particles, MBOAT7 (mGFP-tagged) - Human membrane bound O-acyltransferase domain containing 7 (MBOAT7), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
LENG4 (MBOAT7) (NM_024298) Human Tagged ORF Clone
RG201320

USD 460.00

In Stock

MBOAT7 (GFP-tagged) - Human membrane bound O-acyltransferase domain containing 7 (MBOAT7), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
LENG4 (MBOAT7) Human Gene Knockout Kit (CRISPR)
KN401320

USD 1,290.00

2 Weeks

MBOAT7 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN401320 is the updated version of KN201320.
Mboat7 (NM_029934) Mouse Tagged ORF Clone
MG207548

USD 390.00

3 Weeks

Mboat7 (GFP-tagged) - Mouse leukocyte receptor cluster (LRC) member 4 (Leng4)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Mboat7 (NM_029934) Mouse Tagged ORF Clone
MR207548L3

USD 550.00

3 Weeks

Lenti ORF clone of Mboat7 (Myc-DDK-tagged) - Mouse membrane bound O-acyltransferase domain containing 7 (Mboat7)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Mboat7 (NM_029934) Mouse Tagged ORF Clone Lentiviral Particle
MR207548L3V

USD 750.00

6 Weeks

Lenti ORF particles, Mboat7 (Myc-DDK-tagged) - Mouse membrane bound O-acyltransferase domain containing 7 (Mboat7), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Mboat7 (NM_029934) Mouse Tagged ORF Clone
MR207548L4

USD 550.00

3 Weeks

Lenti ORF clone of Mboat7 (mGFP-tagged) - Mouse membrane bound O-acyltransferase domain containing 7 (Mboat7)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Mboat7 (NM_029934) Mouse Tagged ORF Clone Lentiviral Particle
MR207548L4V

USD 750.00

6 Weeks

Lenti ORF particles, Mboat7 (GFP-tagged) - Mouse membrane bound O-acyltransferase domain containing 7 (Mboat7), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
LENG4 (MBOAT7) (NM_024298) Human Tagged ORF Clone
RC201320L3

USD 620.00

3 Weeks

Lenti ORF clone of Human membrane bound O-acyltransferase domain containing 7 (MBOAT7), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
LENG4 (MBOAT7) (NM_024298) Human Tagged ORF Clone Lentiviral Particle
RC201320L3V

USD 820.00

6 Weeks

Lenti ORF particles, MBOAT7 (Myc-DDK tagged) - Human membrane bound O-acyltransferase domain containing 7 (MBOAT7), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
LENG4 (MBOAT7) (NM_024298) Human Tagged ORF Clone
RC201320L4

USD 620.00

3 Weeks

Lenti ORF clone of Human membrane bound O-acyltransferase domain containing 7 (MBOAT7), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
LENG4 (MBOAT7) (NM_001146082) Human Tagged ORF Clone
RC228833L3

USD 620.00

3 Weeks

Lenti ORF clone of Human membrane bound O-acyltransferase domain containing 7 (MBOAT7), transcript variant 4, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
LENG4 (MBOAT7) (NM_001146082) Human Tagged ORF Clone Lentiviral Particle
RC228833L3V

USD 820.00

7 Weeks

Lenti ORF particles, MBOAT7 (Myc-DDK tagged) - Human membrane bound O-acyltransferase domain containing 7 (MBOAT7), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
LENG4 (MBOAT7) (NM_001146082) Human Tagged ORF Clone
RC228833L4

USD 620.00

3 Weeks

Lenti ORF clone of Human membrane bound O-acyltransferase domain containing 7 (MBOAT7), transcript variant 4, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
LENG4 (MBOAT7) (NM_001146082) Human Tagged ORF Clone Lentiviral Particle
RC228833L4V

USD 820.00

7 Weeks

Lenti ORF particles, MBOAT7 (mGFP-tagged) - Human membrane bound O-acyltransferase domain containing 7 (MBOAT7), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
LENG4 (MBOAT7) (NM_001146083) Human Tagged ORF Clone
RC228875

USD 420.00

3 Weeks

MBOAT7 (Myc-DDK-tagged)-Human membrane bound O-acyltransferase domain containing 7 (MBOAT7), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
LENG4 (MBOAT7) (NM_001146083) Human Tagged ORF Clone
RC228875L3

USD 620.00

3 Weeks

Lenti-ORF clone of MBOAT7 (Myc-DDK-tagged)-Human membrane bound O-acyltransferase domain containing 7 (MBOAT7), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
LENG4 (MBOAT7) (NM_001146083) Human Tagged ORF Clone Lentiviral Particle
RC228875L3V

USD 820.00

6 Weeks

Lenti ORF particles, MBOAT7 (Myc-DDK-tagged)-Human membrane bound O-acyltransferase domain containing 7 (MBOAT7), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
LENG4 (MBOAT7) (NM_001146083) Human Tagged ORF Clone
RC228875L4

USD 620.00

3 Weeks

Lenti-ORF clone of MBOAT7 (mGFP-tagged)-Human membrane bound O-acyltransferase domain containing 7 (MBOAT7), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
LENG4 (MBOAT7) (NM_001146083) Human Tagged ORF Clone Lentiviral Particle
RC228875L4V

USD 820.00

6 Weeks

Lenti ORF particles, MBOAT7 (mGFP-tagged)-Human membrane bound O-acyltransferase domain containing 7 (MBOAT7), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
LENG4 (MBOAT7) (NM_001146056) Human Tagged ORF Clone
RC228876

USD 420.00

3 Weeks

MBOAT7 (Myc-DDK-tagged)-Human membrane bound O-acyltransferase domain containing 7 (MBOAT7), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
LENG4 (MBOAT7) (NM_001146056) Human Tagged ORF Clone
RC228876L3

USD 620.00

3 Weeks

Lenti-ORF clone of MBOAT7 (Myc-DDK-tagged)-Human membrane bound O-acyltransferase domain containing 7 (MBOAT7), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
LENG4 (MBOAT7) (NM_001146056) Human Tagged ORF Clone Lentiviral Particle
RC228876L3V

USD 820.00

6 Weeks

Lenti ORF particles, MBOAT7 (Myc-DDK-tagged)-Human membrane bound O-acyltransferase domain containing 7 (MBOAT7), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
LENG4 (MBOAT7) (NM_001146056) Human Tagged ORF Clone
RC228876L4

USD 620.00

3 Weeks

Lenti-ORF clone of MBOAT7 (mGFP-tagged)-Human membrane bound O-acyltransferase domain containing 7 (MBOAT7), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
LENG4 (MBOAT7) (NM_001146056) Human Tagged ORF Clone Lentiviral Particle
RC228876L4V

USD 820.00

6 Weeks

Lenti ORF particles, MBOAT7 (mGFP-tagged)-Human membrane bound O-acyltransferase domain containing 7 (MBOAT7), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
LENG4 (MBOAT7) (NM_001146082) Human Tagged ORF Clone
RG228833

USD 460.00

3 Weeks

MBOAT7 (GFP-tagged) - Human membrane bound O-acyltransferase domain containing 7 (MBOAT7), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
LENG4 (MBOAT7) (NM_001146083) Human Tagged ORF Clone
RG228875

USD 460.00

5 Weeks

MBOAT7 (GFP-tagged) - Human membrane bound O-acyltransferase domain containing 7 (MBOAT7), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
LENG4 (MBOAT7) (NM_001146056) Human Tagged ORF Clone
RG228876

USD 460.00

5 Weeks

MBOAT7 (GFP-tagged) - Human membrane bound O-acyltransferase domain containing 7 (MBOAT7), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Mboat7 (NM_001134978) Rat Tagged ORF Clone
RR203336

USD 650.00

4 Weeks

Mboat7 (Myc-DDK-tagged ORF) - Rat leukocyte receptor cluster (LRC) member 4 (Leng4), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Mboat7 (NM_001134978) Rat Tagged ORF Clone
RR203336L3

USD 840.00

9 Weeks

Lenti ORF clone of Mboat7 (Myc-DDK-tagged ORF) - Rat leukocyte receptor cluster (LRC) member 4 (Leng4), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Mboat7 (NM_001134978) Rat Tagged ORF Clone Lentiviral Particle
RR203336L3V

USD 1,060.00

13 Weeks

Lenti ORF particles, Mboat7 (Myc-DDK-tagged ORF) - Rat leukocyte receptor cluster (LRC) member 4 (Leng4), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Mboat7 (NM_001134978) Rat Tagged ORF Clone
RR203336L4

USD 920.00

9 Weeks

Lenti ORF clone of Mboat7 (mGFP-tagged ORF) - Rat leukocyte receptor cluster (LRC) member 4 (Leng4), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Mboat7 (NM_001134978) Rat Tagged ORF Clone Lentiviral Particle
RR203336L4V

USD 1,180.00

13 Weeks

Lenti ORF particles, Mboat7 (GFP-tagged ORF) - Rat leukocyte receptor cluster (LRC) member 4 (Leng4), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
LENG4 (MBOAT7) Rabbit Polyclonal Antibody
TA338652

USD 310.00

2 Weeks

Rabbit Polyclonal Anti-MBOAT7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LENG4 antibody: synthetic peptide directed towards the C terminal of human LENG4. Synthetic peptide located within the following region: LSAYWHGLHPGYYLSFLTIPLCLAAEGRLESALRGRLSPGGQKAWDWVHW
LENG4 (MBOAT7) (NM_024298) Human Over-expression Lysate
LY411319

USD 396.00

In Stock

Transient overexpression lysate of membrane bound O-acyltransferase domain containing 7 (MBOAT7), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

Mboat7 (NM_029934) Mouse Untagged Clone
MC203010

USD 210.00

In Stock

Mboat7 (untagged) - Mouse membrane bound O-acyltransferase domain containing 7 (Mboat7), (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
LENG4 (MBOAT7) (NM_024298) Human Untagged Clone
SC320015

USD 760.00

In Stock

MBOAT7 (untagged)-Human membrane bound O-acyltransferase domain containing 7 (MBOAT7), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
SC320015 is the updated version of SC106173.
LENG4 (MBOAT7) (NM_024298) Human Tagged ORF Clone
RC201320L2

USD 620.00

3 Weeks

Lenti ORF clone of Human membrane bound O-acyltransferase domain containing 7 (MBOAT7), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
LENG4 (MBOAT7) (NM_001146082) Human Tagged ORF Clone
RC228833L2

USD 620.00

3 Weeks

Lenti ORF clone of Human membrane bound O-acyltransferase domain containing 7 (MBOAT7), transcript variant 4, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
LENG4 (MBOAT7) Rabbit Polyclonal Antibody
TA338651

USD 375.00

5 Days

Rabbit Polyclonal Anti-MBOAT7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LENG4 antibody: synthetic peptide directed towards the C terminal of human LENG4. Synthetic peptide located within the following region: WWLAQYIYKSAPARSYVLRSAWTMLLSAYWHGLHPGYYLSFLTIPLCLAA
Human LENG4 (MBOAT7) activation kit by CRISPRa
GA112381

USD 1,290.00

2 Weeks

MBOAT7 CRISPRa kit - CRISPR gene activation of human membrane bound O-acyltransferase domain containing 7

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Mboat7 activation kit by CRISPRa
GA210774

USD 1,290.00

2 Weeks

Mboat7 CRISPRa kit - CRISPR gene activation of mouse membrane bound O-acyltransferase domain containing 7

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector