Products

View as table Download

SAMM50 (Myc-DDK-tagged)-Human sorting and assembly machinery component 50 homolog (S. cerevisiae) (SAMM50)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Samm50 (Myc-DDK-tagged) - Mouse sorting and assembly machinery component 50 homolog (S. cerevisiae) (Samm50)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

SAMM50 (GFP-tagged) - Human sorting and assembly machinery component 50 homolog (S. cerevisiae) (SAMM50)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

SAMM50 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN404029 is the updated version of KN204029.

Samm50 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN515282 is the updated version of KN315282.

Samm50 (GFP-tagged) - Mouse sorting and assembly machinery component 50 homolog (S. cerevisiae) (Samm50), (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Samm50 (Myc-DDK-tagged) - Mouse sorting and assembly machinery component 50 homolog (S. cerevisiae) (Samm50)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Samm50 (Myc-DDK-tagged) - Mouse sorting and assembly machinery component 50 homolog (S. cerevisiae) (Samm50), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Samm50 (mGFP-tagged) - Mouse sorting and assembly machinery component 50 homolog (S. cerevisiae) (Samm50)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Samm50 (GFP-tagged) - Mouse sorting and assembly machinery component 50 homolog (S. cerevisiae) (Samm50), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human sorting and assembly machinery component 50 homolog (S. cerevisiae) (SAMM50), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, SAMM50 (Myc-DDK tagged) - Human sorting and assembly machinery component 50 homolog (S. cerevisiae) (SAMM50), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human sorting and assembly machinery component 50 homolog (S. cerevisiae) (SAMM50), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, SAMM50 (mGFP-tagged) - Human sorting and assembly machinery component 50 homolog (S. cerevisiae) (SAMM50), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Samm50 (Myc-DDK-tagged ORF) - Rat sorting and assembly machinery component 50 homolog (S. cerevisiae) (Samm50), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Samm50 (Myc-DDK-tagged ORF) - Rat sorting and assembly machinery component 50 homolog (S. cerevisiae) (Samm50), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Samm50 (Myc-DDK-tagged ORF) - Rat sorting and assembly machinery component 50 homolog (S. cerevisiae) (Samm50), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Samm50 (mGFP-tagged ORF) - Rat sorting and assembly machinery component 50 homolog (S. cerevisiae) (Samm50), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Samm50 (GFP-tagged ORF) - Rat sorting and assembly machinery component 50 homolog (S. cerevisiae) (Samm50), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Recombinant protein of human sorting and assembly machinery component 50 homolog (S. cerevisiae) (SAMM50), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli

SAMM50 (untagged)-Human sorting and assembly machinery component 50 homolog (S. cerevisiae) (SAMM50)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

SAMM50 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Rabbit Polyclonal Anti-SAMM50 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SAMM50 Antibody is: synthetic peptide directed towards the N-terminal region of Human SAMM50. Synthetic peptide located within the following region: GLGRTKDDIIICEIGDVFKAKNLIEVMRKSHEAREKLLRLGIFRQVDVLI

SAMM50 CRISPRa kit - CRISPR gene activation of human SAMM50 sorting and assembly machinery component

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

Samm50 CRISPRa kit - CRISPR gene activation of mouse SAMM50 sorting and assembly machinery component

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

qPCR primer pairs and template standards against Homo sapiens gene SAMM50

Application Plasmid of exact quantity for transcript copy number calculation

qSTAR qPCR primer pairs against Homo sapiens gene SAMM50

Transient overexpression lysate of sorting and assembly machinery component 50 homolog (S. cerevisiae) (SAMM50)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Samm50 (untagged) - Mouse sorting and assembly machinery component 50 homolog (S. cerevisiae) (Samm50), (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

qSTAR qPCR primer pairs against Mus musculus gene Samm50

Samm50 (untagged ORF) - Rat sorting and assembly machinery component 50 homolog (S. cerevisiae) (Samm50), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

3`UTR clone of sorting and assembly machinery component 50 homolog (S. cerevisiae) (SAMM50) for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase

SAMM50 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Samm50 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Samm50 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

SAMM50 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human SAMM50

SAMM50 Rabbit polyclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human SAMM50 (NP_056195.3).
Modifications Unmodified

Transient overexpression of SAMM50 (NM_015380) in HEK293T cells paraffin embedded controls for ICC/IHC staining

SAMM50 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti

SAMM50 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Format Lentiviral particles
Vector pGFP-C-shLenti

Samm50 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti

Samm50 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Format Lentiviral particles
Vector pGFP-C-shLenti

Samm50 - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti

Samm50 - Rat shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Format Lentiviral particles
Vector pGFP-C-shLenti

SAMM50 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS

Samm50 - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS

Samm50 - Rat, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS

USD 225.00

4 Weeks

Transient overexpression of SAMM50 (NM_015380) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of SAMM50 (NM_015380) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack