SAMM50 (Myc-DDK-tagged)-Human sorting and assembly machinery component 50 homolog (S. cerevisiae) (SAMM50)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
SAMM50 (Myc-DDK-tagged)-Human sorting and assembly machinery component 50 homolog (S. cerevisiae) (SAMM50)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Samm50 (Myc-DDK-tagged) - Mouse sorting and assembly machinery component 50 homolog (S. cerevisiae) (Samm50)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
SAMM50 (GFP-tagged) - Human sorting and assembly machinery component 50 homolog (S. cerevisiae) (SAMM50)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
SAMM50 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Samm50 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Samm50 (GFP-tagged) - Mouse sorting and assembly machinery component 50 homolog (S. cerevisiae) (Samm50), (10ug)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Samm50 (Myc-DDK-tagged) - Mouse sorting and assembly machinery component 50 homolog (S. cerevisiae) (Samm50)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Samm50 (Myc-DDK-tagged) - Mouse sorting and assembly machinery component 50 homolog (S. cerevisiae) (Samm50), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Samm50 (mGFP-tagged) - Mouse sorting and assembly machinery component 50 homolog (S. cerevisiae) (Samm50)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Samm50 (GFP-tagged) - Mouse sorting and assembly machinery component 50 homolog (S. cerevisiae) (Samm50), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human sorting and assembly machinery component 50 homolog (S. cerevisiae) (SAMM50), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, SAMM50 (Myc-DDK tagged) - Human sorting and assembly machinery component 50 homolog (S. cerevisiae) (SAMM50), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human sorting and assembly machinery component 50 homolog (S. cerevisiae) (SAMM50), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, SAMM50 (mGFP-tagged) - Human sorting and assembly machinery component 50 homolog (S. cerevisiae) (SAMM50), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Samm50 (Myc-DDK-tagged ORF) - Rat sorting and assembly machinery component 50 homolog (S. cerevisiae) (Samm50), (10 ug)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Samm50 (Myc-DDK-tagged ORF) - Rat sorting and assembly machinery component 50 homolog (S. cerevisiae) (Samm50), (10 ug)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Samm50 (Myc-DDK-tagged ORF) - Rat sorting and assembly machinery component 50 homolog (S. cerevisiae) (Samm50), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Samm50 (mGFP-tagged ORF) - Rat sorting and assembly machinery component 50 homolog (S. cerevisiae) (Samm50), (10 ug)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Samm50 (GFP-tagged ORF) - Rat sorting and assembly machinery component 50 homolog (S. cerevisiae) (Samm50), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Recombinant protein of human sorting and assembly machinery component 50 homolog (S. cerevisiae) (SAMM50), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug
Tag | N-His |
Expression Host | E. coli |
SAMM50 (untagged)-Human sorting and assembly machinery component 50 homolog (S. cerevisiae) (SAMM50)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
SAMM50 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-SAMM50 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SAMM50 Antibody is: synthetic peptide directed towards the N-terminal region of Human SAMM50. Synthetic peptide located within the following region: GLGRTKDDIIICEIGDVFKAKNLIEVMRKSHEAREKLLRLGIFRQVDVLI |
SAMM50 CRISPRa kit - CRISPR gene activation of human SAMM50 sorting and assembly machinery component
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Samm50 CRISPRa kit - CRISPR gene activation of mouse SAMM50 sorting and assembly machinery component
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene SAMM50
Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene SAMM50
Transient overexpression lysate of sorting and assembly machinery component 50 homolog (S. cerevisiae) (SAMM50)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Samm50 (untagged) - Mouse sorting and assembly machinery component 50 homolog (S. cerevisiae) (Samm50), (10ug)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Samm50
Samm50 (untagged ORF) - Rat sorting and assembly machinery component 50 homolog (S. cerevisiae) (Samm50), (10 ug)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
3`UTR clone of sorting and assembly machinery component 50 homolog (S. cerevisiae) (SAMM50) for miRNA target validation
Vector | pMirTarget |
Mammalian Cell Selection | Neomycin |
Species | Human |
Transfection Reporter | RFP |
Assay Reporter | Luciferase |
SAMM50 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Samm50 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Samm50 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
SAMM50 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SAMM50 |
SAMM50 Rabbit polyclonal Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human SAMM50 (NP_056195.3). |
Modifications | Unmodified |
Transient overexpression of SAMM50 (NM_015380) in HEK293T cells paraffin embedded controls for ICC/IHC staining
SAMM50 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
Format | Lentiviral plasmids |
Vector | pGFP-C-shLenti |
SAMM50 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
Format | Lentiviral particles |
Vector | pGFP-C-shLenti |
Samm50 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
Format | Lentiviral plasmids |
Vector | pGFP-C-shLenti |
Samm50 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
Format | Lentiviral particles |
Vector | pGFP-C-shLenti |
Samm50 - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector
Format | Lentiviral plasmids |
Vector | pGFP-C-shLenti |
Samm50 - Rat shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
Format | Lentiviral particles |
Vector | pGFP-C-shLenti |
SAMM50 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
Format | Retroviral plasmids |
Vector | pRS |
Samm50 - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector
Format | Retroviral plasmids |
Vector | pRS |
Samm50 - Rat, 4 unique 29mer shRNA constructs in retroviral untagged vector
Format | Retroviral plasmids |
Vector | pRS |
Transient overexpression of SAMM50 (NM_015380) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of SAMM50 (NM_015380) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack