Products

View as table Download

SPDYC - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN423498 is the updated version of KN223498.

Lenti ORF particles, SPDYC (Myc-DDK tagged) - Human speedy homolog C (Xenopus laevis) (SPDYC), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

SPDYC (GFP-tagged) - Human speedy homolog C (Xenopus laevis) (SPDYC)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human speedy homolog C (Xenopus laevis) (SPDYC), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Rabbit Polyclonal Anti-SPDYC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SPDYC Antibody is: synthetic peptide directed towards the N-terminal region of Human SPDYC. Synthetic peptide located within the following region: PISISYEMSDSQDPTTSPVVTTQVELGGCSRQGGGNGFLRFRQHQEVQAF

SPDYC CRISPRa kit - CRISPR gene activation of human speedy/RINGO cell cycle regulator family member C

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

SPDYC HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

SPDYC (untagged)-Human speedy homolog C (Xenopus laevis) (SPDYC)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Transient overexpression of SPDYC (NM_001008778) in HEK293T cells paraffin embedded controls for ICC/IHC staining

SPDYC - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS

Transient overexpression of SPDYC (NM_001008778) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of SPDYC (NM_001008778) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack