Germany
Japan
United Kingdom
China
TAS2R3 (Myc-DDK-tagged)-Human taste receptor, type 2, member 3 (TAS2R3)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
TAS2R3 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN422347 is the updated version of KN222347.
Lenti ORF clone of Human taste receptor, type 2, member 3 (TAS2R3), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, TAS2R3 (Myc-DDK tagged) - Human taste receptor, type 2, member 3 (TAS2R3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human taste receptor, type 2, member 3 (TAS2R3), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, TAS2R3 (mGFP-tagged) - Human taste receptor, type 2, member 3 (TAS2R3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
TAS2R3 (GFP-tagged) - Human taste receptor, type 2, member 3 (TAS2R3)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Transient overexpression lysate of taste receptor, type 2, member 3 (TAS2R3)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Rabbit Polyclonal Anti-TAS2R3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TAS2R3 Antibody is: synthetic peptide directed towards the middle region of Human TAS2R3. Synthetic peptide located within the following region: VMVWMLLGALLLSCGSTASLINEFKLYSVFRGIEATRNVTEHFRKKRSEY |
Rabbit Polyclonal Anti-TAS2R3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TAS2R3 Antibody is: synthetic peptide directed towards the C-terminal region of Human TAS2R3. Synthetic peptide located within the following region: RQMLQNGTSSRDPTTEAHKRAIRIILSFFFLFLLYFLAFLIASFGNFLPK |
TAS2R3 CRISPRa kit - CRISPR gene activation of human taste 2 receptor member 3
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qSTAR qPCR primer pairs against Homo sapiens gene TAS2R3
TAS2R3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
TAS2R3 (untagged)-Human taste receptor, type 2, member 3 (TAS2R3)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
TAS2R3 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Transient overexpression of TAS2R3 (NM_016943) in HEK293T cells paraffin embedded controls for ICC/IHC staining
TAS2R3 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
TAS2R3 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
TAS2R3 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Transient overexpression of TAS2R3 (NM_016943) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of TAS2R3 (NM_016943) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- TAS2R3