Products

View as table Download

TM6SF2 (Myc-DDK-tagged)-Human transmembrane 6 superfamily member 2 (TM6SF2)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

TM6SF2 (GFP-tagged) - Human transmembrane 6 superfamily member 2 (TM6SF2)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Tm6sf2 (Myc-DDK-tagged) - Mouse transmembrane 6 superfamily member 2 (Tm6sf2)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

TM6SF2 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN414298 is the updated version of KN214298.

Tm6sf2 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN517645 is the updated version of KN317645.

Tm6sf2 (GFP-tagged) - Mouse transmembrane 6 superfamily member 2 (Tm6sf2)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Tm6sf2 (Myc-DDK-tagged) - Mouse transmembrane 6 superfamily member 2 (Tm6sf2)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Tm6sf2 (Myc-DDK-tagged) - Mouse transmembrane 6 superfamily member 2 (Tm6sf2), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Tm6sf2 (mGFP-tagged) - Mouse transmembrane 6 superfamily member 2 (Tm6sf2)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Tm6sf2 (GFP-tagged) - Mouse transmembrane 6 superfamily member 2 (Tm6sf2), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Tm6sf2 (myc-DDK-tagged) - Mouse transmembrane 6 superfamily member 2 (Tm6sf2), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human transmembrane 6 superfamily member 2 (TM6SF2), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human transmembrane 6 superfamily member 2 (TM6SF2), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Tm6sf2 (Myc-DDK-tagged ORF) - Rat transmembrane 6 superfamily member 2 (Tm6sf2), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Tm6sf2 (Myc-DDK-tagged ORF) - Rat transmembrane 6 superfamily member 2 (Tm6sf2), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Tm6sf2 (Myc-DDK-tagged ORF) - Rat transmembrane 6 superfamily member 2 (Tm6sf2), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Tm6sf2 (mGFP-tagged ORF) - Rat transmembrane 6 superfamily member 2 (Tm6sf2), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Tm6sf2 (GFP-tagged ORF) - Rat transmembrane 6 superfamily member 2 (Tm6sf2), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

TM6SF2 (untagged)-Human transmembrane 6 superfamily member 2 (TM6SF2)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Lenti ORF clone of Human transmembrane 6 superfamily member 2 (TM6SF2), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Tm6sf2 (untagged) - Mouse transmembrane 6 superfamily member 2 (Tm6sf2), (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin

Lenti ORF clone of Human transmembrane 6 superfamily member 2 (TM6SF2), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Rabbit Polyclonal Anti-TM6SF2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TM6SF2 antibody is: synthetic peptide directed towards the C-terminal region of Human TM6SF2. Synthetic peptide located within the following region: FFTLFRGLVVLDCPTDACFVYIYQYEPYLRDPVAYPKVQMLMYMFYVLPF

TM6SF2 CRISPRa kit - CRISPR gene activation of human transmembrane 6 superfamily member 2

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

Tm6sf2 CRISPRa kit - CRISPR gene activation of mouse transmembrane 6 superfamily member 2

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

qSTAR qPCR primer pairs against Homo sapiens gene TM6SF2

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)

TM6SF2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Tm6sf2 (untagged) - Mouse transmembrane 6 superfamily member 2 (Tm6sf2), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

qPCR primer pairs and template standards against Mus musculus gene Tm6sf2

Application Plasmid of exact quantity for transcript copy number calculation

qSTAR qPCR primer pairs against Mus musculus gene Tm6sf2

Tm6sf2 (untagged ORF) - Rat transmembrane 6 superfamily member 2 (Tm6sf2), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

TM6SF2 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Tm6sf2 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).
SR426609 is the updated version of SR412756.

Tm6sf2 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

TM6SF2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human TM6SF2.

USD 1,070.00

4 Weeks

Transient overexpression of TM6SF2 (NM_001001524) in HEK293T cells paraffin embedded controls for ICC/IHC staining

TM6SF2 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti

TM6SF2 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Format Lentiviral particles
Vector pGFP-C-shLenti

Tm6sf2 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti

Tm6sf2 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Format Lentiviral particles
Vector pGFP-C-shLenti

Tm6sf2 - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti

Tm6sf2 - Rat shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Format Lentiviral particles
Vector pGFP-C-shLenti

TM6SF2 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS

Tm6sf2 - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS

Tm6sf2 - Rat, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS