Scn2a Mouse Monoclonal Antibody [Clone ID: K69/3]

CAT#: 73-024

Scn2a mouse monoclonal antibody, clone K69/3

Product Images

Adult rat hippocampus immunohistochemistry

• 

  Whole brain immunohistochemistry

• 

  adult rat brain membrane immunoblot

• 

  Immunoblot against crude membrane fractions from whole mouse (MBM) or rat (RBM) brain and from human hippocampus [HBM(H)], cerebral cortex [HBM(Cx)] or cerebellum [HBM(Cb)] and probed with K69/3 (left) or N52A/42 (right) TC supe.

Specifications

Product Data

• Clone Name: K69/3
• Applications: IHC, IP, WB
• Recommended Dilution: Immunoblot (IB)
  Immunohistochemistry (IHC)
  Immunoprecipitation (IP)
• Reactivities: Human, Mouse, Rat
• Host: Mouse
• Isotype: IgG2a
• Clonality: Monoclonal
• Immunogen: Fusion protein amino acids 1882-2005 (cytoplasmic C-terminus, RFMASNPSKVSYEPITTTLKRKQEEVSAIVIQRAYRRYLLKQKVKKVSSIYKKDKGKEDEGTPIKEDIITDKLNENSTPEKTDVTPSTTSPPSYDSVTKPEKEKFEKDKSEKEDKGKDIRESKK) of rat Voltage-gated sodium channel subunit alpha Nav1.2, Sodium channel protein type 2 subunit alpha, Sodium channel protein brain II subunit alpha, HBSC II, NAC2, Scn2a, Scn2a1, Scn2a2, accession number P04775).
  Mouse: 100% identity (124/124 amino acids identical).
  Human: 94% identity (117/124 amino acids identical).
  >60% identity with Nav1.1, Nav1.3 and Nav1.7.
• Specificity: Does not cross-react with Nav1.1/3/7
• Formulation: State: Supernatant
• Conjugation: Unconjugated
• Gene Name: sodium voltage-gated channel alpha subunit 2
• Database Link:
  Entrez Gene 24766 Rat
  UniProt ID P04775
• Synonyms: NAC2, SCN2A1, SCN2A2, HBSC II
• Note: USERS will cite the UC Davis/NIH NeuroMab Facility in any publication(s) describing the research utilizing the MATERIALS. The suggested acknowledgment statement is as follows:
  "The monoclonal antibody _ was developed by and/or obtained from the UC Davis/NIH NeuroMab Facility, supported by NIH grant U24NS050606 and maintained by the Department of Neurobiology, Physiology and Behavior, College of Biological Sciences, University of California, Davis, CA 95616."
  Also, please include the complete clone number (e.g., N52A/42) and the Antibody Registry identification number (e.g., RRID:AB_2120479) to avoid ambiguity.
  View Research License Agreement