Atxn1 Mouse Monoclonal Antibody [Clone ID: N76/8]

CAT#: 73-117

Atxn1 mouse monoclonal antibody, clone N76/8


USD 530.00

3 Weeks*

Size
    • 5 ml

Product Images

Specifications

Product Data
Clone Name N76/8
Applications IHC, IP, WB
Recommended Dilution Immunoblot (IB)
Immunohistochemistry (IHC)
Immunoprecipitation (IP)
Reactivities Human, Mouse, Rat
Host Mouse
Isotype IgG2b
Clonality Monoclonal
Immunogen Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse ataxin-1 (also known as spinocerebellar ataxia type 1 protein homolog accession number P54254). 
Rat: 100% identity (34/34 amino acids identical).
Human: 88% identity (30/34 amino acids identical).
Formulation State: Supernatant
Conjugation Unconjugated
Gene Name ataxin 1
Synonyms Ataxin 1, ATXN1, ATX1, SCA1
Note USERS will cite the UC Davis/NIH NeuroMab Facility in any publication(s) describing the research utilizing the MATERIALS. The suggested acknowledgment statement is as follows:
"The monoclonal antibody _ was developed by and/or obtained from the UC Davis/NIH NeuroMab Facility, supported by NIH grant U24NS050606 and maintained by the Department of Neurobiology, Physiology and Behavior, College of Biological Sciences, University of California, Davis, CA 95616."
Also, please include the complete clone number (e.g., N52A/42) and the Antibody Registry identification number (e.g., RRID:AB_2120479) to avoid ambiguity.
View Research License Agreement
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.