Gria2 Mouse Monoclonal Antibody [Clone ID: L21/32]

CAT#: 75-002

Gria2 mouse monoclonal antibody, clone L21/32

Product Images

Adult rat hippocampus immunohistochemistry

• 

  Electron micrograph of L21/32 hippocampal labelling using a postembedding immunogold method. Immunoparticles (arrows) were observed in the postsynaptic densities of dendritic spines and dendritic shafts (Den) establishing asymmetrical synapses with axon terminals (b). Image courtesy of Rafael Lujan (Universidad de Castilla-La Mancha).

• 

  immunoblot against crude membrane fractions from whole mouse (MBM) or rat (RBM) brain and from human cerebral cortex [HBM(Cx)] or hippocampus [HBM(H)] and probed with L21/32 (left) or N52A/42 (right) TC supe.

• 

  Adult rat brain membrane immunoblot

• 

  immunoblot of membranes from adult rat brain (RBM) and adult GluA2/GluR2 knockout (KO) and wild-type (WT) mouse hippocampi (MHM). Mouse samples courtesy of Richard Huganir (Johns Hopkins University).

Show all 5 images

Specifications

Product Data

• Clone Name: L21/32
• Applications: IHC, WB
• Recommended Dilution: Immunoblot (IB)
  Immunohistochemistry (IHC)
  Immuno-gold EM
• Reactivities: Human, Mouse, Rat
• Host: Mouse
• Isotype: IgG1
• Clonality: Monoclonal
• Immunogen: Fusion protein amino acids 834-883 (EFCYKSRAEAKRMKVAKNPQNINPSSSQNSQNFATYKEGY NVYGIESVKI, cytoplasmic C-terminus) of rat GluA2/GluR2 (also known as Glutamate receptor 2, AMPA-selective glutamate receptor 2, Glutamate receptor ionotropic AMPA 2, GluR-B, GluR-K2 and Gria2, accession number P19491).
  Mouse: 98% identity (49/50 amino acids identical)
  Human: 98% identity (49/50 amino acids identical) 100% identity between Flip and Flop isoforms
  >70% identity with GluA3/GluR3 and less identity with GluA1/GluR1 and GluA4/GluR4
• Formulation: State: Purified
• Conjugation: Unconjugated
• Gene Name: glutamate ionotropic receptor AMPA type subunit 2
• Database Link:
  Entrez Gene 29627 Rat
  UniProt ID P19491
• Synonyms: GluR-B, GluR-K2, Glutamate receptor ionotropic, AMPA2, GRIA2
• Note: USERS will cite the UC Davis/NIH NeuroMab Facility in any publication(s) describing the research utilizing the MATERIALS. The suggested acknowledgment statement is as follows:
  "The monoclonal antibody _ was developed by and/or obtained from the UC Davis/NIH NeuroMab Facility, supported by NIH grant U24NS050606 and maintained by the Department of Neurobiology, Physiology and Behavior, College of Biological Sciences, University of California, Davis, CA 95616."
  Also, please include the complete clone number (e.g., N52A/42) and the Antibody Registry identification number (e.g., RRID:AB_2120479) to avoid ambiguity.
  View Research License Agreement