Scn2a Mouse Monoclonal Antibody [Clone ID: K69/3]

CAT#: 75-024

Scn2a mouse monoclonal antibody, clone K69/3


USD 530.00

3 Weeks*

Size
    • 100 ul

Product Images

Specifications

Product Data
Clone Name K69/3
Applications IHC, IP, WB
Recommended Dilution Immunoblot (IB)
Immunohistochemistry (IHC)
Immunoprecipitation (IP)
Reactivities Human, Mouse, Rat
Host Mouse
Isotype IgG2a
Clonality Monoclonal
Immunogen Fusion protein amino acids 1882-2005 (cytoplasmic C-terminus, RFMASNPSKVSYEPITTTLKRKQEEVSAIVIQRAYRRYLLKQKVKKVSSIYKKDKGKEDEGTPIKEDIITDKLNENSTPEKTDVTPSTTSPPSYDSVTKPEKEKFEKDKSEKEDKGKDIRESKK) of rat Voltage-gated sodium channel subunit alpha Nav1.2, Sodium channel protein type 2 subunit alpha, Sodium channel protein brain II subunit alpha, HBSC II, NAC2, Scn2a, Scn2a1, Scn2a2, accession number P04775).
Mouse: 100% identity (124/124 amino acids identical).
Human: 94% identity (117/124 amino acids identical).
>60% identity with Nav1.1, Nav1.3 and Nav1.7.
Specificity Does not cross-react with Nav1.1/3/7
Formulation State: Purified
Conjugation Unconjugated
Gene Name sodium voltage-gated channel alpha subunit 2
Synonyms NAC2, SCN2A1, SCN2A2, HBSC II
Note USERS will cite the UC Davis/NIH NeuroMab Facility in any publication(s) describing the research utilizing the MATERIALS. The suggested acknowledgment statement is as follows:
"The monoclonal antibody _ was developed by and/or obtained from the UC Davis/NIH NeuroMab Facility, supported by NIH grant U24NS050606 and maintained by the Department of Neurobiology, Physiology and Behavior, College of Biological Sciences, University of California, Davis, CA 95616."
Also, please include the complete clone number (e.g., N52A/42) and the Antibody Registry identification number (e.g., RRID:AB_2120479) to avoid ambiguity.
View Research License Agreement
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.