LTBR Rabbit Polyclonal Antibody

CAT#: TA329151

Rabbit Polyclonal anti-LTBR Antibody

Product Images

Host: Rabbit; Target Name: LTBR; Sample Tissue: HepG2 Whole cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-LTBR antibody is: synthetic peptide directed towards the N-terminal region of Human LTBR. Synthetic peptide located within the following region: VLGLFGLLAASQPQAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 47 kDa
• Gene Name: lymphotoxin beta receptor
• Database Link:
  NP_002333
  Entrez Gene 4055 Human
  UniProt ID P36941
• Background: This gene encodes a member of the tumor necrosis factor receptor superfamily. The major ligands of this receptor include lymphotoxin alpha/beta and tumor necrosis factor ligand superfamily member 14. The encoded protein plays a role in signalling during the development of lymphoid and other organs, lipid metabolism, immune response, and programmed cell death. Activity of this receptor has also been linked to carcinogenesis. Alternatively spliced transcript variants encoding multiple isoforms have been observed.
• Synonyms: CD18; D12S370; LT-BETA-R; TNF-R-III; TNFCR; TNFR-RP; TNFR2-RP; TNFR3; TNFRSF3
• Note: Immunogen sequence homology: Human: 100%; Goat: 90%; Bovine: 90%; Pig: 85%; Rat: 85%; Rabbit: 85%; Guinea pig: 85%; Dog: 77%; Mouse: 77%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Cytokine-cytokine receptor interaction