RAD17 Rabbit Polyclonal Antibody

CAT#: TA329154

Rabbit Polyclonal anti-RAD17 antibody

Product Images

WB Suggested Anti-RAD17 Antibody Titration: 1 ug/ml; Positive Control: Fetal liver cell lysate

• 

  WB Suggested Anti-RAD17 Antibody ; Positive Control: Lane 1: 25ug HeLa lysate, Lane 2: 25ug Xenopus laevis egg extract, Lane 3: 25ug mouse embryonic stem cell lysate, Lane 4: 25ug HEK293T lysate; Primary Antibody Dilution : 1:500; Secondary Antibody : Anti-rabbit-HRP; Secondry Antibody Dilution : 1:3000; Submitted by: Domenico Maiorano, Institute of Human Genetics, CNRS

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse, Xenopus
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RAD17 antibody: synthetic peptide directed towards the N terminal of human RAD17. Synthetic peptide located within the following region: MNQVTDWVDPSFDDFLECSGVSTITATSLGVNNSSHRRKNGPSTLESSRF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 76 kDa
• Gene Name: RAD17 checkpoint clamp loader component
• Database Link:
  NP_002864
  Entrez Gene 19356 MouseEntrez Gene 5884 Human
  UniProt ID O75943
• Background: RAD17 is highly similar to the gene product of Schizosaccharomyces pombe rad17, a cell cycle checkpoint gene required for cell cycle arrest and DNA damage repair in response to DNA damage. This protein shares strong similarity with DNA replication factor C (RFC), and can form a complex with RFCs. This protein binds to chromatin prior to DNA damage and is phosphorylated by ATR after the damage. This protein recruits the RAD1-RAD9-HUS1 checkpoint protein complex onto chromatin after DNA damage, which may be required for its phosphorylation.
• Synonyms: CCYC; HRAD17; R24L; RAD17SP; RAD24
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Human: 100%; Rabbit: 100%; Horse: 92%; Rat: 89%; Bovine: 89%

Reference Data

• Protein Families: Druggable Genome