HTR2B Rabbit Polyclonal Antibody

CAT#: TA329175

Rabbit Polyclonal anti-HTR2B antibody

Product Images

Host: Rabbit; Target Name: HTR2B; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0ug/ml

• 

  Host: Rabbit; Target Name: HTR2B; Sample Tissue: Human Fetal Muscle; Antibody Dilution: 1.0ug/ml

• 

  Host: Rabbit; Target Name: HTR2B; Sample Tissue: Human Fetal Lung; Antibody Dilution: 1.0ug/ml

• 

  WB Suggested Anti-HTR2B Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: 721_B cell lysateHTR2B is supported by BioGPS gene expression data to be expressed in 721_B

• 

  Immunofluorescence-- 1.3ug/mL

Show all 5 images

Specifications

Product Data

• Applications: IF, WB
• Recommended Dilution: WB, IF
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HTR2B antibody: synthetic peptide directed towards the N terminal of human HTR2B. Synthetic peptide located within the following region: QTESIPEEMKQIVEEQGNKLHWAALLILMVIIPTIGGNTLVILAVSLEKK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 54 kDa
• Gene Name: 5-hydroxytryptamine receptor 2B
• Database Link:
  NP_000858
  Entrez Gene 15559 MouseEntrez Gene 3357 Human
  UniProt ID P41595
• Background: Multiple receptor subtypes of serotonin neurotransmitters with multiple physiologic functions have been recognized. The 5-HT-2 receptors mediate many of the central and peripheral physiologic functions of serotonin. Cardiovascular effects include contraction of blood vessels and shape changes in platelets; central nervous system effects include neuronal sensitization to tactile stimuli and mediation of hallucinogenic effects of phenylisopropylamine hallucinogens.
• Synonyms: 5-HT(2B); 5-HT2B
• Note: Immunogen sequence homology: Human: 100%; Bovine: 100%; Horse: 93%; Pig: 87%; Guinea pig: 85%; Dog: 80%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Calcium signaling pathway, Gap junction, Neuroactive ligand-receptor interaction