Tcf3 Rabbit Polyclonal Antibody

CAT#: TA329196

Rabbit Polyclonal anti-Tcf3 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "Tcf3"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Rat
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-Tcf3 antibody is: synthetic peptide directed towards the C-terminal region of Rat Tcf3. Synthetic peptide located within the following region: ARERLRVRDINEAFKELGRMCQLHLSTEKPQTKLLILHQAVAVILSLEQQ
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 71 kDa
Gene Name transcription factor 3
Background Tcf3 is a transcriptional regulator; It binds enhancer motifs of pancreatic exocrine genes.
Synonyms bHLHb21; E2A; ITF1; MGC129647; MGC129648; TCF-3; VDIR
Note Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Guinea pig: 100%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Zebrafish: 93%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.