Tcf3 Rabbit Polyclonal Antibody

CAT#: TA329196

Rabbit Polyclonal anti-Tcf3 Antibody

Product Images

Host: Rabbit; Target Name: Tcf3; Sample Tissue: Rat Testis lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Tcf3 antibody is: synthetic peptide directed towards the C-terminal region of Rat Tcf3. Synthetic peptide located within the following region: ARERLRVRDINEAFKELGRMCQLHLSTEKPQTKLLILHQAVAVILSLEQQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 71 kDa
• Gene Name: transcription factor 3
• Database Link:
  NP_598208
  Entrez Gene 171046 Rat
  UniProt ID P21677
• Background: Tcf3 is a transcriptional regulator; It binds enhancer motifs of pancreatic exocrine genes.
• Synonyms: bHLHb21; E2A; ITF1; MGC129647; MGC129648; TCF-3; VDIR
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Guinea pig: 100%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Zebrafish: 93%