GTF2A1 Rabbit Polyclonal Antibody

CAT#: TA329243

Rabbit Polyclonal anti-GTF2A1 antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "GTF2A1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-GTF2A1 antibody: synthetic peptide directed towards the C terminal of human GTF2A1. Synthetic peptide located within the following region: QAPLVLQVDGTGDTSSEEDEDEEEDYDDDEEEDKEKDGAEDGQVEEEPLN
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 37 kDa
Gene Name general transcription factor IIA subunit 1
Background Transcription initiation factor IIA . and . chains (GTF2A1, TFIIA p35 and p19 subunits, TFIIAL) binding ability of TLP is required for characteristic cytoplasmic localization of TLP. TFIIA may regulate the intracellular molecular state and the function of TLP through its property of binding to TLP.
Synonyms TF2A1; TFIIA; TFIIA-42; TFIIAL
Note Immunogen sequence homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Guinea pig: 93%; Yeast: 91%; Zebrafish: 85%
Reference Data
Protein Families Transcription Factors
Protein Pathways Basal transcription factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.