MYF6 Rabbit Polyclonal Antibody

CAT#: TA329269

Rabbit Polyclonal anti-MYF6 antibody

Product Images

WB Suggested Anti-MYF6 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: 293T cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MYF6 antibody: synthetic peptide directed towards the middle region of human MYF6. Synthetic peptide located within the following region: LQDLLHRLDQQEKMQELGVDPFSYRPKQENLEGADFLRTCSSQWPSVSDH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 27 kDa
• Gene Name: myogenic factor 6
• Database Link:
  NP_002460
  Entrez Gene 4618 Human
  UniProt ID P23409
• Background: MYF6 is a part of the myogenic basic helix-loop-helix family of transcription factors, and can activate the muscle differentiation program.
• Synonyms: bHLHc4; CNM3; MRF4; myf-6
• Note: Immunogen sequence homology: Pig: 100%; Goat: 100%; Horse: 100%; Human: 100%; Sheep: 100%; Bovine: 100%; Rat: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 92%; Mouse: 79%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors