SPI1 Rabbit Polyclonal Antibody

CAT#: TA329273

Rabbit Polyclonal anti-SPI1 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "SPI1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-SPI1 antibody is: synthetic peptide directed towards the N-terminal region of Human SPI1. Synthetic peptide located within the following region: MEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPH
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 26 kDa
Gene Name Spi-1 proto-oncogene
Background The function of this protein remains unknown.
Synonyms OF; PU.1; SFPI1; SPI-1; SPI-A
Note Immunogen sequence homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Rat: 77%; Guinea pig: 77%
Reference Data
Protein Families Transcription Factors
Protein Pathways Acute myeloid leukemia, Pathways in cancer

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.