TAF10 Rabbit Polyclonal Antibody

CAT#: TA329277

Rabbit Polyclonal anti-TAF10 antibody

Product Images

WB Suggested Anti-TAF10 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TAF10 antibody: synthetic peptide directed towards the C terminal of human TAF10. Synthetic peptide located within the following region: DALQHCKMKGTASGSSRSKSKDRKYTLTMEDLTPALSEYGINVKKPHYFT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 22 kDa
• Gene Name: TATA-box binding protein associated factor 10
• Database Link:
  NP_006275
  Entrez Gene 24075 MouseEntrez Gene 6881 Human
  UniProt ID Q12962
• Background: TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. TAF10 is one of the small subunits of TFIID that is associated with a subset of TFIID complexes. It is required for transcriptional activation by the estrogen receptor, for progression through the cell cycle, and may also be required for certain cellular differentiation programs.
• Synonyms: TAF2A; TAF2H; TAFII30
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Basal transcription factors