TFIIE beta (GTF2E2) Rabbit Polyclonal Antibody

CAT#: TA329281

Rabbit Polyclonal anti-GTF2E2 antibody

Product Images

WB Suggested Anti-GTF2E2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Daudi cell lysateGTF2E2 is supported by BioGPS gene expression data to be expressed in Daudi

• 

  Rabbit Anti-GTF2E2 Antibody; Paraffin Embedded Tissue: Human cardiac cell; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GTF2E2 antibody: synthetic peptide directed towards the N terminal of human GTF2E2. Synthetic peptide located within the following region: VEHGGSSGSKQNSDHSNGSFNLKALSGSSGYKFGVLAKIVNYMKTRHQRG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 33 kDa
• Gene Name: general transcription factor IIE subunit 2
• Database Link:
  NP_002086
  Entrez Gene 2961 Human
  UniProt ID P29084
• Background: Recruits TFIIH to the initiation complex and stimulates the RNA polymerase II C-terminal domain kinase and DNA-dependent ATPase activities of TFIIH. Both TFIIH and TFIIE are required for promoter clearance by RNA polymerase.
• Synonyms: FE; TF2E2; TFIIE-B
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%; Zebrafish: 85%; Goat: 79%

Reference Data

• Protein Families: Transcription Factors
• Protein Pathways: Basal transcription factors