RBM6 Rabbit Polyclonal Antibody

CAT#: TA329296

Rabbit Polyclonal anti-RBM6 antibody

Product Images

WB Suggested Anti-RBM6 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: HepG2 cell lysateRBM6 is supported by BioGPS gene expression data to be expressed in HepG2

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RBM6 antibody: synthetic peptide directed towards the N terminal of human RBM6. Synthetic peptide located within the following region: RNRDVSDLDFRDKDGTQVDFRGRGSGTTDLDFRDRDTPHSDFRGRHRSRT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 129 kDa
• Gene Name: RNA binding motif protein 6
• Database Link:
  NP_005768
  Entrez Gene 10180 Human
  UniProt ID P78332
• Background: RBM6 contains 1 G-patch domain and 1 RRM (RNA recognition motif) domain.It specifically binds poly(G) RNA homopolymers in vitro.
• Synonyms: 3G2; DEF-3; DEF3; g16; HLC-11; NY-LU-12
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rat: 93%; Guinea pig: 93%; Rabbit: 86%