OLIG2 Rabbit Polyclonal Antibody

CAT#: TA329297

Rabbit Polyclonal anti-OLIG2 antibody

Product Images

OLIG2 antibody - N-terminal region validated by WB using human LCL and mouse brains at 1:1000.

• 

  WB Suggested Anti-OLIG2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Transfected 293T

• 

  Sample Type: Human Optic Nerve and Spinal CordCellular Target: Oligoden Drocyte Lineage Cells; Dilution: 1:500

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-OLIG2 antibody: synthetic peptide directed towards the N terminal of human OLIG2. Synthetic peptide located within the following region: MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 32 kDa
• Gene Name: oligodendrocyte lineage transcription factor 2
• Database Link:
  NP_005797
  Entrez Gene 50913 MouseEntrez Gene 10215 Human
  UniProt ID Q13516
• Background: OLIG2 is a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. OLIG2 is an essential regulator of ventral neuroectodermal progenitor cell fate. It is associated with T-cell acute lymphoblastic leukemia due to a chromosomal translocation t(14;21)(q11.2;q22). OLIG2 might play a role in learning deficits associated with Down syndrome.This gene encodes a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. The protein is an essential regulator of ventral neuroectodermal progenitor cell fate. The gene is involved in a chromosomal translocation t(14;21)(q11.2;q22) associated with T-cell acute lymphoblastic leukemia. Its chromosomal location is within a region of chromosome 21 which has been suggested to play a role in learning deficits associated with Down syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: BHLHB1; bHLHe19; OLIGO2; PRKCBP2; RACK17
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Zebrafish: 85%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors