TCFL5 Rabbit Polyclonal Antibody

CAT#: TA329309

Rabbit Polyclonal anti-TCFL5 antibody

Product Images

WB Suggested Anti-TCFL5 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: HepG2 cell lysateTCFL5 is supported by BioGPS gene expression data to be expressed in HepG2

• 

  Human kidney

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TCFL5 antibody: synthetic peptide directed towards the middle region of human TCFL5. Synthetic peptide located within the following region: TLIRHPSELMNVPLQQQNKCTALVKNKTAATTTALQFTYPLFTTNACSTS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 53 kDa
• Gene Name: transcription factor like 5
• Database Link:
  NP_006593
  Entrez Gene 10732 Human
  UniProt ID Q9UL49
• Background: TCFL5 is a new bHLH transcription factor that negatively regulates upstream transcription factor-dependent transcription.
• Synonyms: bHLHe82; CHA; E2BP-1; Figlb; SOSF1
• Note: Immunogen sequence homology: Human: 100%; Rat: 93%; Mouse: 93%; Dog: 86%; Pig: 86%; Horse: 86%; Bovine: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors